ESTScan Details for Unigene SGN-U230733

Score 
656
Direction 
Forward
Predicted Peptide Sequence 
VCDHLFRHFQAISAEGNGVVTEETIQRAFLETERGFTSVVSENWHSRPQLATVGACCLVGAIYQQTLFVANLGDSRVVLGKKVGNTGEIA
AMQLSTEHNANIESVRWEQKDLHPNDPQIVVLRHGVWRVKGIIQVSRSIGDVYLKHTRFCREPTNGKFRVPQPLNMPILLATPTILKHPL
HPNDSFLIFASDGLWEHLSNEKAVEIVKSHPRKGSAKRLVKAALHVAAKKREMRYSDLRNIDKKXPTSFSR
Predicted Coding Sequence 
GTTTGTGATCACTTATTTCGACATTTCCAAGCAATATCAGCTGAAGGAAATGGTGTAGTCACAGAGGAGACAATTCAAAGGGCCTTTCTT
GAGACAGAGAGAGGGTTTACTTCTGTTGTTTCGGAAAATTGGCATTCTCGACCACAACTAGCAACAGTGGGGGCATGCTGCCTGGTTGGA
GCTATATATCAGCAGACACTCTTTGTAGCAAATCTTGGTGACTCTCGTGTAGTCCTTGGAAAGAAGGTTGGAAACACTGGAGAAATTGCT
GCCATGCAGCTATCAACGGAGCATAATGCCAATATTGAGTCTGTTAGGTGGGAGCAAAAAGACTTGCATCCAAATGATCCTCAAATTGTT
GTTCTTAGACATGGTGTTTGGAGGGTAAAAGGAATAATTCAGGTCTCAAGATCCATTGGTGATGTTTATCTTAAACACACAAGATTTTGC
AGGGAACCAACAAATGGAAAATTCAGAGTTCCTCAACCCCTTAATATGCCTATCCTGTTGGCCACTCCAACAATTTTAAAACATCCTCTA
CATCCAAATGACTCCTTCCTCATATTTGCTTCTGATGGTCTATGGGAGCACTTGAGCAATGAAAAGGCCGTTGAAATTGTGAAGAGTCAC
CCTCGTAAAGGAAGTGCAAAGAGGCTTGTCAAGGCTGCTCTCCATGTAGCTGCCAAAAAAAGAGAGATGCGATATTCTGATCTTCGAAAC
ATTGACAAAAAGGXTCCGACGTCATTTTCACGATGA\
Edits in Original Sequence 
(5')GTTTGTGATCACTTATTTCGACATTTCCAAGCAATATCAGCTGAAGGAAATGGTGTAGTCACAGAGGAGACAATTCAAAGGGCCTT
TCTTGAGACAGAGAGAGGGTTTACTTCTGTTGTTTCGGAAAATTGGCATTCTCGACCACAACTAGCAACAGTGGGGGCATGCTGCCTGGT
TGGAGCTATATATCAGCAGACACTCTTTGTAGCAAATCTTGGTGACTCTCGTGTAGTCCTTGGAAAGAAGGTTGGAAACACTGGAGAAAT
TGCTGCCATGCAGCTATCAACGGAGCATAATGCCAATATTGAGTCTGTTAGGTGGGAGCAAAAAGACTTGCATCCAAATGATCCTCAAAT
TGTTGTTCTTAGACATGGTGTTTGGAGGGTAAAAGGAATAATTCAGGTCTCAAGATCCATTGGTGATGTTTATCTTAAACACACAAGATT
TTGCAGGGAACCAACAAATGGAAAATTCAGAGTTCCTCAACCCCTTAATATGCCTATCCTGTTGGCCACTCCAACAATTTTAAAACATCC
TCTACATCCAAATGACTCCTTCCTCATATTTGCTTCTGATGGTCTATGGGAGCACTTGAGCAATGAAAAGGCCGTTGAAATTGTGAAGAG
TCACCCTCGTAAAGGAAGTGCAAAGAGGCTTGTCAAGGCTGCTCTCCATGTAGCTGCCAAAAAAAGAGAGATGCGATATTCTGATCTTCG
AAACATTGACAAAAAGGXTCCGACGTCATTTTCACGATGA\(3')TATAACTGTAATTATTTTATTCTTAAACATGACCTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan