ESTScan Details for Unigene SGN-U230934

Score 
268
Direction 
Reverse
Predicted Peptide Sequence 
KNILKGTTYSPPSPTNSDNEMDDNISEVNEKKFVVYASIKYAQFRSRTAGTKCVHIVYWRYAXHKKPNPTTTSPIVPVCPFCRSNIVQLD
VIKLEKDDGTSPDIVSPSKLRKSRRSRNFSEGSSSFKGLSAVSSFGRMVGRGSGRIAAENEYIDKPIILD
Predicted Coding Sequence 
AAGAACATCCTGAAAGGAACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGAGATGGATGACAATATCTCTGAGGTCAATGAA
AAGAAATTTGTTGTATATGCTTCGATCAAGTATGCACAATTCAGGTCCAGGACTGCGGGCACCAAATGTGTGCACATTGTGTACTGGCGT
TATGCTGXTCATAAAAAGCCTAATCCTACTACTACCAGTCCTATTGTACCTGTGTGCCCATTCTGTCGTAGCAACATTGTTCAATTAGAT
GTTATCAAGCTGGAAAAGGACGATGGGACTAGCCCCGATATTGTTTCCCCTTCAAAGCTTAGGAAGTCTAGGCGATCAAGAAACTTCAGC
GAGGGGAGTAGCAGTTTTAAGGGCTTATCTGCAGTAAGCTCTTTTGGAAGAATGGTTGGTCGTGGCTCTGGTAGAATTGCTGCTGAAAAC
GAATACATTGATAAGCCAATAATCCTTGACTAA\
Edits in Original Sequence 
(5')AAGAACATCCTGAAAGGAACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGAGATGGATGACAATATCTCTGAGGTCAA
TGAAAcAGAAATTTGTTGTATATGCTTCGATCAAGTATGCACAATTCAGGTCCAGGACTGCGGGCACCAAATGTGTGCACATTGTGTACT
GGCGTTATGCTGXTCATAAAAAGCCTAATCCTACTACTACCAGTCCTATTGTACCTGTGTGCCCATTCTGTCGTAGCAACATTGTTCAAT
TAGATGTTATCAAGCTGGAAAAGGACGATGGGACTAGCCCCGATATTGTTTCCCCTTCAAAGCTTAGGAAGTCTAGGCGATCAAGAAACT
TCAGCGAGGGGAGTAGCAGTTTTAAGGGCTTATCTGCAGTAAGCTCTTTTGGAAGAATGGTTGGTCGTGGCTCTGGTAGAATTGCTGCTG
AAAACGAATACATTGATAAGCCAATAATCCTTGACTAA\(3')TTGCAGAATTTTGCATCAAGACTTCCAATTAGCATGATTTTTTAAGA
GCATCCTAAATGGTATATATCGATAAATCTCTCTCCAATCTCTTGTTACCACATTTTTTTACAGTTGAAATAGAAGGAATTCTTTGACAG
TTGCCTCATTTTTTGTTCTGTTTTGTCCTGGCTGATGAAAATTCAACATTCTCTCGATGTGTAATGTTATAGGAACAGNCCATAATATAA
ATATGAAAGTCTAATAATTTGTGAATGAAAATGACATTTCTTGCCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan