Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U230988

Score 
436
Direction 
Forward
Predicted Peptide Sequence 
AVERYKARLVAKGYSQQEGLDYTEIFSPVSKMVTVRSVVAVATAKHWSIFQMDVHNAFLQGDLMEEVYLEVPSGFASQEGKHVVCKLHKS
LYGLKQAPRQWNKKLTDALVQLGFSQSHFDYSLFTKTVQGKLVIVLVYVDDFQVTGSXYRLDSTNKDDLKLKFKMKDLGELKFFLGIQFA
RSQKGIVMSQRKYALELIIELGLX
Predicted Coding Sequence 
GCTGTGGAAAGGTACAAGGCTCGACTTGTGGCAAAGGGTTATAGCCAACAAGAGGGGTTAGATTACACTGAGATCTTCTCTCCAGTTTCT
AAGATGGTTACTGTCAGGTCGGTTGTGGCTGTGGCAACAGCTAAACATTGGTCTATTTTTCAGATGGATGTTCATAATGCTTTTCTTCAA
GGGGATTTAATGGAGGAGGTGTATTTAGAGGTTCCTTCTGGTTTTGCCAGCCAGGAGGGGAAACATGTTGTCTGCAAATTACATAAGTCT
CTTTATGGACTCAAACAGGCGCCTAGGCAATGGAACAAGAAACTCACAGATGCATTGGTACAACTTGGCTTCTCACAAAGTCATTTTGAC
TATTCTTTATTCACCAAGACAGTTCAAGGAAAGCTGGTAATTGTCTTAGTTTATGTGGATGATTTTCAGGTAACAGGAAGCAAXTACAGA
CTTGATTCTACAAACAAGGATGACTTAAAGCTAAAGTTCAAAATGAAAGATCTTGGAGAATTGAAGTTTTTTCTAGGAATTCAATTTGCT
AGATCACAAAAGGGAATAGTGATGAGCCAAAGGAAGTATGCATTGGAACTAATTATTGAGTTGGGATTANGA\
Edits in Original Sequence 
(5')GCTGTGGAAAGGTACAAGGCTCGACTTGTGGCAAAGGGTTATAGCCAACAAGAGGGGTTAGATTACACTGAGATCTTCTCTCCAGT
TTCTAAGATGGTTACTGTCAGGTCGGTTGTGGCTGTGGCAACAGCTAAACATTGGTCTATTTTTCAGATGGATGTTCATAATGCTTTTCT
TCAAGGGGATTTAATGGAGGAGGTGTATTTAGAGGTTCCTTCTGGTTTTGCCAGCCAGGAGGGGAAACATGTTGTCTGCAAATTACATAA
GTCTCTTTATGGACTCAAACAGGCGCCTAGGCAATGGAACAAGAAACTCACAGATGCATTGGTACAACTTGGCTTCTCACAAAGTCATTT
TGACTATTCTTTATTCACCAAGACAGTTCAAGGAAAGCTGGTAATTGTCTTAGTTTATGTGGATGATTTTCAGGTAACAGGAAGCAAXTA
CAGACTTGATTCTACAAACAAGGATGACTTAAAGCTAAAGTTCAAAATGAAAGATCTTGGAGAATTGAAGTTTTTTCTAGGAATTCAATT
TGCTAGATCACAAAAGGGAATAGTGATGAGCCAAAGGAAGTATGCATTGGAACTAATTATTGAGTTGGGATTANGA\(3')GGAACTAAA
CTAGNTTACACACCTTTGGAACAAATCTGAAGCTACATCAGTTGACTATGATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan