ESTScan Details for Unigene SGN-U231063

Score 
642
Direction 
Forward
Predicted Peptide Sequence 
MDSYKNEEETSDDHNNDEQEESGWTTYLEDFSMEQHNNNSINNNNSEISTYCDSFGSPSLLSDAASHVVWNNNHQVMINTSNYGSPFLKR
LNLKKPRNNKISDPDLQDTASSPVNSPKVSSFNKQMDINYRRGDNNNNGNFQGFEGSSRQHQEMETIEKNSSMCFDERNKSYMDLKKNGL
CLGPLSMLVNYRG
Predicted Coding Sequence 
ATGGATTCATATAAGAATGAAGAAGAAACAAGTGATGATCATAATAATGATGAACAAGAAGAAAGTGGATGGACAACTTATTTGGAGGAT
TTTTCAATGGAACAACATAACAATAACAGCATTAATAATAATAATAGTGAAATTAGCACATATTGTGATAGTTTTGGAAGTCCATCTTTG
TTGTCTGATGCTGCTTCTCATGTTGTTTGGAACAATAATCATCAAGTCATGATTAATACAAGTAATTATGGCTCACCATTTCTTAAGAGA
TTAAATTTGAAGAAACCAAGGAACAACAAAATCTCTGATCCTGATTTACAAGACACTGCTAGCTCACCTGTCAATAGTCCAAAGGTAAGT
AGTTTTAATAAGCAGATGGACATCAATTACCGAAGAGGAGACAACAATAATAATGGAAATTTTCAGGGATTTGAAGGTAGCTCTAGACAA
CATCAAGAAATGGAAACAATAGAAAAAAATAGTAGTATGTGTTTTGATGAAAGGAACAAAAGTTATATGGACCTCAAGAAGAATGGACTA
TGTTTGGGTCCTTTGTCCATGTTGGTCAACTATAGAGGGTGA\
Edits in Original Sequence 
ATCAAATTCCCTCAATAATGCAAACAAATTATATTTCCCCAAATTAAAGCAAAAAATTGAATTTGGTCTTATAAGAAA(5')ATGGATTC
ATATAAGAATGAAGAAGAAACAAGTGATGATCATAATAATGATGAACAAGAAGAAAGTGGATGGACAACTTATTTGGAGGATTTTTCAAT
GGAACAACATAACAATAACAGCATTAATAATAATAATAGTGAAATTAGCACATATTGTGATAGTTTTGGAAGTCCATCTTTGTTGTCTGA
TGCTGCTTCTCATGTTGTTTGGAACAATAATCATCAAGTCATGATTAATACAAGTAATTATGGCTCACCATTTCTTAAGAGATTAAATTT
GAAGAAACCAAGGAACAACAAAATCTCTGATCCTGATTTACAAGACACTGCTAGCTCACCTGTCAATAGTCCAAAGGTAAGTAGTTTTAA
TAAGCAGATGGACATCAATTACCGAAGAGGAGACAACAATAATAATGGAAATTTTCAGGGATTTGAAGGTAGCTCTAGACAACATCAAGA
AATGGAAACAATAGAAAAAAATAGTAGTATGTGTTTTGATGAAAGGAACAAAAGTTATATGGACCTCAAGAAGAATGGACTATGTTTGGG
TCCTTTGTCCATGTTGGTCAACTATAGAGGGTGA\(3')TGTTCATATGAGCTGCGCGTTTTCGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan