Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U231179

Score 
279
Direction 
Forward
Predicted Peptide Sequence 
IGITGPPFNKLGGNIPEKLASLTFLSFLNLSSNELVGMIPQGSQIRTFGESSFEGNKGLCGLPLNRTCKNNSSDAPSEPEVEEDEFISRT
EIYVSTILGFVVGXWDHLSTTSGLKKMEPVVQQNNGQINFKYFQQQVEERRTSTSSVALGKKQQGNQEADINFTGCDTSLQHAAHY
Predicted Coding Sequence 
XCAATTGGAATCACTGGACCTCCATTCAACAAGTTAGGTGGCAATATCCCAGAAAAACTTGCTAGCCTCACATTTCTTTCCTTCTTAAAT
TTATCATCTAATGAATTGGTCGGAATGATACCACAAGGCAGCCAAATTCGAACATTTGGAGAAAGTTCTTTTGAAGGAAACAAGGGGCTA
TGTGGGTTACCGCTGAACAGAACTTGCAAGAATAATTCATCAGACGCACCTTCAGAGCCAGAAGTTGAAGAGGACGAATTCATTTCAAGG
ACGGAGATTTATGTAAGCACTATATTGGGATTTGTTGTTGGTAXTTGGGATCATCTTTCTACCACTTCTGGTCTCAAAAAGATGGAACCA
GTCGTACAACAGAATAATGGACAGATTAATTTTAAGTATTTTCAGCAGCAAGTTGAAGAAAGGCGAACTAGTACCAGTAGTGTAGCTCTT
GGAAAAAAGCAGCAGGGAAATCAAGAGGCAGACATTAATTTCACAGGATGTGACACTTCCTTGCAGCATGCTGCTCACTATTAG\
Edits in Original Sequence 
(5')XCAATTGGAATCACTGGACCTCtCATTCAACAAGTTAGGTGGCAATATCCCAGAAAAACTTGCTAGCCTCACATTTCTTTCCTTCT
TAAATTTATCATCTAATGAATTGGTCGGAATGATACCACAAGGCAGCCAAATTCGAACATTTGGAGAAAGTTCTTTTGAAGGAAACAAGG
GGCTATGTGGGTTACCGCTGAACAGAACTTGCAAGAATAATTCATCAGACGCACCTTCAGAGCCAGAAGTTGAAGAGGACGAATTCATTT
CAAGGACGGAGATTTATGTAAGCACTATATTGGGATTTGTTGTTGGTAXTTGGGATCATCTTTCTACCACTTCTGGTCTCAAAAAGATGG
AACCAGTCGTACAACAGAATAATGGACAGATTAATTTTAAGTATaTTTCAGCAGCAAGTTGAAGAAAGGCGAACTAGTACCAGTAGTGTA
GCaTCTTGGAAAAAAGCAGCAGGGAAATCAAGAGGCAGACATTAATTTCACAGGATGTGACACTTCCTTGCAGCATGCTGCTCACTATTA
G\(3')TACTTCTAATTGTTTCCACTATGAGTTATCAGTGTTTATTTACCTTTCATATTCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan