ESTScan Details for Unigene SGN-U231239

Score 
186
Direction 
Reverse
Predicted Peptide Sequence 
KGKFISYFKAGKMFRKGYIYHLIRVHDIKAEALTLQSVSVVNEFPDVFPEELPGLPPEREIEFTIDVLPDTQPISIPPYRMAPAELKELK
EQLRDLLEKGFIRPSTSPWGAPVLFVRKKDGSLRMCIDYRQLNKVTIMNRYPLPRIDDLFDQLQGAKGFSKIDLRSGYHQVRVREADIPM
TAFRTRYGHYVFRVLSFGLTIAPAVFMDLMN
Predicted Coding Sequence 
AAAGGTAAGTTCATTTCATACTTCAAGGCCGGGAAGATGTTTAGAAAAGGCTATATTTACCATCTGATTCGGGTGCATGACATAAAGGCA
GAGGCACTGACTCTTCAATCAGTCTCGGTAGTTAATGAATTTCCTGATGTATTCCCCGAGGAACTTCCAGGCCTTCCTCCAGAACGGGAG
ATAGAGTTTACTATAGATGTACTGCCAGATACCCAACCTATATCTATACCTCCTTATAGAATGGCACCTGCTGAGTTGAAAGAATTGAAA
GAGCAATTGAGGGATTTACTAGAAAAGGGCTTCATCAGGCCTAGTACGTCACCTTGGGGAGCACCGGTACTATTTGTGAGGAAGAAGGAT
GGGTCGCTCCGGATGTGCATTGATTATAGGCAGCTGAACAAAGTAACAATAATGAACAGGTATCCCCTCCCAAGGATTGACGATCTATTT
GACCAGTTGCAGGGTGCAAAGGGTTTTTCAAAGATAGACTTGCGGTCAGGTTATCATCAGGTACGGGTTAGGGAGGCAGATATCCCAATG
ACGGCATTCCGGACCCGATATGGGCATTATGTGTTTAGAGTGTTGTCTTTTGGGCTGACTATTGCTCCAGCGGTATTCATGGATTTAATG
AATTGA\
Edits in Original Sequence 
(5')AAAGGTAAGTTCATTTCATACTTCAAGGCCGGGAAGATGTTTAGAAAAGGCTATATTTACCATCTGATTCGGGTGCATGACATAAA
GGCAGAGGCACTGACTCTTCAATCAGTCTCGGTAGTTAATGAATTTCCTGATGTATTCCCCGAGGAACTTCCAGGCCTTCCTCCAGAACG
GGAGATAGAGTTTACTATAGATGTACTGCCAGATACCCAACCTATATCTATACCTCCTTATAGAATGGCACCTGCTGAGTTGAAAGAATT
GAAAGAGCAATTGAGGGATTTACTAGAAAAGGGCTTCATCAGGCCTAGTACGTCACCTTGGGGAGCACCGGTACTATTTGTGAGGAAGAA
GGATGGGTCGCTCCGGATGTGCATTGATTATAGGCAGCTGAACAAAGTAACAATAATGAACAGGTATCCCCTCCCAAGGATTGACGATCT
ATTTGACCAGTTGCAGGGTGCAAAGGGTTTTTCAAAGATAGACTTGCGGTCAGGTTATCATCAGGTACGGGTTAGGGAGGCAGATATCCC
AATGACGGCATTCCGGACCCGATATGGGCATTATGTGTTTAGAGTGTTGTCTTTTGGGCTGACTATTGCTCCAGCGGTATTCATGGATTT
AATGAATTGA\(3')GTATTTAATCCATTCCTTGATATGTTTGTTATTGGATTTATAGACGATATTCTGGTCTATTCACGTTCAGAAGAG
GAGCATGAAGACTATTTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan