ESTScan Details for Unigene SGN-U231540

Score 
533
Direction 
Forward
Predicted Peptide Sequence 
WFKMELTNSRGTSLREKIIRGSSLRGSLSRKRNSTNNSRWNGNDGEIFNRSTRDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGASAEI
DIHDIGFQERNKLLERLVKVADEDNEKLLLKLKQRIDRVGIDLPEIEVRYEHLTIEADAYVGSRALPTFINFISNFFEDILNSXPYPTES
KEETNFLNDVSGIIKPRRLTLLLGPPSSGKTTLLLALAGKLDSALKVTGKVTYNGHEMNEFVPQRTAAYISQYDLHIGEMTV
Predicted Coding Sequence 
XTTTGGTTCAAAATGGAGCTAACTAATTCAAGAGGTACTAGTTTAAGAGAAAAAATAATCAGGGGAAGTAGTTTGAGAGGGAGCTTAAGT
AGAAAGAGGAATAGTACTAACAACTCCAGGTGGAATGGCAATGATGGGGAGATTTTTAATCGTTCAACGAGAGACGAAGATGATGAAGAG
GCTCTTAAATGGGCAGCTCTTGAAAAACTTCCAACGTTTGATCGTTTGAGAAAAGGTCTCTTGTTTGGATCACAAGGTGCATCTGCTGAA
ATTGATATACATGATATTGGTTTTCAAGAAAGAAACAAGTTGCTTGAAAGGCTTGTCAAAGTTGCAGATGAGGATAATGAGAAGCTCCTG
TTGAAACTCAAGCAAAGAATTGACAGAGTTGGGATAGATTTGCCTGAAATAGAAGTAAGATATGAGCATTTAACTATTGAGGCAGATGCA
TATGTAGGAAGTAGAGCTTTGCCTACATTTATCAACTTTATCTCTAATTTTTTTGAGGATATATTGAACTCTGXTCCATATCCTACCGAG
TCGAAAGAGGAAACTAACTTTCTTAATGATGTGAGTGGTATCATTAAGCCTCGCAGATTGACTTTGCTTTTAGGACCTCCAAGTTCCGGG
AAAACTACATTATTATTAGCTTTGGCCGGAAAGCTCGACTCTGCCCTTAAGGTTACTGGAAAAGTGACCTATAATGGACATGAAATGAAT
GAGTTTGTGCCGCAAAGAACAGCTGCTTATATTAGCCAGTATGATTTACATATTGGAGAAATGACTGTG\
Edits in Original Sequence 
(5')XTTTGGTTCAAAATGGAGCTAACTAATTCAAGAGGTACTAGTTTAAGAGAAAAAATAATCAGGGGAAGTAGTTTGAGAGGGAGCTT
AAGTAGAAAGAGGAATAGTACTAACAACTCCAGGTGGAATGGCAATGATGGGGAGATTTTTAATCGTTCAACGAGAGACGAAGATGATGA
AGAGGCTCTTAAATGGGCAGCTCTTGAAAAACTTCCAACGTTTGATCGTTTGAGAAAAGGTCTCTTGTTTGGATCACAAGGTGCATCTGC
TGAAATTGATATACATGATATTGGTTTTCAAGAAAGAAACAAGTTGCTTGAAAGGCTTGTCAAAGTTGCAGATGAGGATAATGAGAAGCT
CCTGTTGAAACTCAAGCAAAGAATTGACAGAGTTGGGATAGATTTGCCTGAAATAGAAGTAAGATATGAGCATTTAACTATTGAGGCAGA
TGCATATGTAGGAAGTAGAGCTTTGCCTACATTTATCAACTTTATCTCTAATTTTTTTGAGGATATATTGAACTCTGXTCCATATCCTAC
CGAGTCGAAAGAGGAAACTAACTaTTCTTAATGATGTGAGTGGTATCATTAAGCCTCGCAGATTGACTTTGCTTTTAGGACCTCCAAGTT
CCGGGAAAACTACATTATTATTAGCTTTGGCCGGAAAGCTCGACTCTGCCCTTAAGGTTACTGGAAAAGTGACCTATAATGGACATGAAA
TGAATGAGTTTGTGCCGCAAAGAACAGCTGCTTATATTAGCCAGTATGATTTACATATTGGAGAAATGACTGTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan