Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U231574

Score 
145
Direction 
Reverse
Predicted Peptide Sequence 
HWYVKSXDLSSNNMVGEIXIEIXISVGFARFEPVEQQLNGQIPLRIGEMKALNFLDLSTNDLTGEIPASLSQLSHLGVLNLSCNNLSGRI
PLGEQLLTFNNRSYIGNHGLCGYPLTEACSLEELPRDSTLSDEDEFITPEFYISMGISFISAFLGVSAHESSYKSRVLETLHLPEFLFDV
HCTPHESANPXNIYTVRVVYLTFMSFSQAKPFIXKEHHRSSECKQEQTSSSASHLELNIDS
Predicted Coding Sequence 
CATTGGTATGTAAAGAGCNTCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGCACGG
TTTGAACCTGTCGAGCAACAACTTAACGGGCAGATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTACAAAT
GATCTTACAGGGGAAATTCCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTCGAATC
CCTTTAGGCGAACAGTTACTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTTGCTCT
CTGGAGGAACTTCCTCGAGACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCTTTATT
TCTGCATTTTTGGGAGTCTCAGCTCATGAAAGTAGCTATAAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATTCGATGTG
CATTGTACACCACACGAATCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCAAGCAAAA
CCATTCATTXTTAAGGAGCACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAATATTGAT
AGC\
Edits in Original Sequence 
(5')CATTGGTATGTAAAGAGCNTCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGC
ACGGTTTGAACCTGTCGAGCAACAACTTAACGGGCAGcATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTA
CAAATGATCTTACAGGGGAAATTCCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTC
GAATCCCTTTAGGCGAACAGTTACTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTT
GCTCTCTGGAGGAACTTCCTCGAGACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCT
TTATTTCTGCATTTTTGGGAGTCTCAGCTCATGAtAAGTAGCTATAtAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATT
CGATGTGCATTGTACACCACACGAATCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCA
AGCAAAACCATTCATTXTTAAGGAGCACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAA
TATTGATAGC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan