ESTScan Details for Unigene SGN-U231580

Score 
363
Direction 
Forward
Predicted Peptide Sequence 
RFEDAEYCLIALKLEGLQLSASIFCVLAHAYAQQGLCEQTVKVLQIMEAEGMEPNLIMLNMLINAFGNAGRHMEAQSIYQHIKEMGITPD
VITYSTLMKAFLRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQRHC
Predicted Coding Sequence 
XGGAGATTTGAGGATGCAGAATATTGTTTAATTGCCCTGAAATTGGAAGGCCTTCAGCTTTCAGCTAGCATCTTTTGTGTCCTGGCCCAT
GCCTATGCTCAGCAGGGATTATGTGAGCAGACTGTGAAGGTTCTACAGATAATGGAAGCCGAAGGGATGGAACCAAACCTTATAATGCTA
AATATGTTGATAAATGCTTTTGGGAATGCTGGTAGGCATATGGAGGCACAATCAATTTACCAGCATATAAAGGAGATGGGTATTACTCCT
GATGTGATTACTTATAGCACTTTAATGAAGGCTTTTTTGAGGGCTAAGAAATTTGATCAGGTCCCCAAGATATATAGTGAAATGGAATCC
ACTGGATGTACGCCAGACAGAAAGGCTAGAGAAATGTTGCAATCAGCATTGATGATCCTTGAACAGAGACACTGTTAG\
Edits in Original Sequence 
(5')XGGAGATTTGAGGATGCAGAATATTGTTTAATTGCCCTGAAATTGGAAGGCCTTCAGCTTTCAGCTAGCATCTTTTGTGTCCTGGC
CCATGCCTATGCTCAGCAGGGATTATGTGAGCAGACTGTGAAGGTTCTACAGATAATGGAAGCCGAAGGGATGGAACCAAACCTTATAAT
GCTAAATATGTTGATAAATGCTTTTGGGAATGCTGGTAGGCATATGGAGGCACAATCAATTTACCAGCATATAAAGGAGATGGGTATTAC
TCCTGATGTGATTACTTATAGCACTTTAATGAAGGCTTTTTTGAGGGCTAAGAAATTTGATCAGGTCCCCAAGATATATAGTGAAATGGA
ATCCACTGGATGTACGCCAGACAGAAAGGCTAGAGAAATGTTGCAATCAGCATTGATGATCCTTGAACAGAGACACTGTTAG\(3')TTT
AAGTATAAGTAGTTAGCCTTATTAGGCTGTATTGCGATTTTGTTAGTTTCTTCAATCAGAAGATGACGTACAGCACCAGAAACTAAAAAC
ACTTTTGATGCTGCTCTCTGTAATCTTTGAGGACTTTGATGCTCAACCCCAGATGTACTTCTCTTCGTCTGCAATATTGCTATATCAACA
AGTGAGAAAAGCAGCGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan