ESTScan Details for Unigene SGN-U231657

Score 
497
Direction 
Forward
Predicted Peptide Sequence 
EVQVVSRSLFPSAEYGFGDRERIATILLKEAAELRRQAQSEGALSYLHRPNVRGRPNSRFLTATVLGVQQANRAVEVNEMWKLRQKEVEL
ENRIMGRSADKNGDTKCHNFSVSERRSRERYDADSGSRGSKKRKIQDSHSSEDEGLRDAEIEEFXTFEGQGGRGTVGSRMDEAGPYLPSS
PDPREKESASPDVKLSKGSGYHVVVGPEKPVWLNSPGSLENESLSDDNRKAPKKAKSSKHHDHCRKHRSKKKSKDREHK
Predicted Coding Sequence 
XTGGAAGTGCAGGTTGTCTCTCGCTCTCTCTTCCCAAGTGCTGAATATGGATTTGGAGACAGAGAAAGAATTGCGACAATTCTTTTGAAA
GAGGCTGCAGAATTGCGGCGGCAAGCACAGTCAGAGGGTGCACTTTCTTATCTTCATCGGCCTAATGTCAGGGGGAGACCAAATTCACGG
TTTTTAACAGCAACTGTTCTTGGAGTACAACAAGCTAACCGGGCTGTTGAAGTAAATGAGATGTGGAAGTTAAGGCAGAAAGAGGTGGAG
CTTGAAAACAGGATCATGGGAAGGTCGGCAGATAAGAACGGTGATACAAAGTGTCATAATTTTAGTGTCTCGGAAAGGAGGTCACGTGAG
AGATATGATGCTGATTCTGGCTCAAGGGGATCAAAGAAAAGGAAGATACAAGATTCTCATTCAAGTGAAGATGAAGGATTGAGAGATGCT
GAAATTGAGGAATTTXCTACATTCGAGGGTCAAGGAGGAAGGGGGACTGTTGGGTCACGGATGGATGAAGCTGGTCCTTACCTTCCTTCT
AGTCCAGATCCCAGAGAAAAAGAGTCAGCAAGTCCTGATGTGAAACTAAGCAAAGGTAGTGGGTATCATGTTGTCGTTGGGCCAGAGAAG
CCCGTCTGGCTGAATTCCCCTGGTTCTTTAGAAAATGAATCTCTGTCAGATGATAATAGAAAGGCCCCAAAGAAGGCTAAATCCAGTAAG
CACCATGACCACTGTAGGAAACATAGATCAAAAAAGAAGTCTAAGGACAGGGAGCATAAA\
Edits in Original Sequence 
(5')XTGGAAGTGCAGGTTGTCTCTCGCTCTCTCTTCCCAAGTGCTGAATATGGATTTGGAGACAGAGAAtAGAATTGCGACAATTCTTT
TGAAAGAGGCTGCAGAATTGCGGCGGCAAGCACAGTCAGAGGGTGCACTTTCTTATCTTCATCGGCCTAATGTCAGGGGGAGACCAAATT
CACGGTTTTTAACAGCAACTGTTCTTGGAGTACAACAAGCTAACCGGGCTGTTGAAGTAAATGAGATGTGGAAGTTAAGGCAGAAAGAGG
TGGAGCTTGAAAACAGGATCATGGGAAGGTCGGCAGATAAGAACGGTGATACAAAGTGTCATAATTTTAGTGTCTCGGAAAGGAGGTCAC
GTGAGAGATATGATGCTGATTCTGGCTCAAGGGGATCAAAGAAAAGGAAGATACAAGATTCTCATTCAAGTGAAGATGAAGGATTGAGAG
ATGCTGAAATTGAGGAATTTXCTACATTCGAGGGTCAAGcGAGGAAGGGGGACTGTTGGGTCACGGATGGATGAAGCTGGTCCTTACCTT
CCTTCTAGTCCAGATCCCAGAGAAAAAGAGTCAGCAAGTCCTGATGTGAAACTAAGCAAAGGTAGTGGGTATCATGTTGTCGTTGGGCCA
GAGAAGCCCGTCTGGCTGAATTCCCCTGGTTCTTTAGAAAATGAATCTCTGTCAGATGATAATAGAAAGGCCCCAAAGAAGGCTAAATCC
AGTAAGCACCATGACCACTGTAGGAAACATAGATCAAAAAAGAAGTCTAAGGACAGGGAGCATAAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan