ESTScan Details for Unigene SGN-U231666

Score 
246
Direction 
Forward
Predicted Peptide Sequence 
CAKLEDIERGKLIHSSISKTPALSNVFVGSALINMYAKCGHLPEAIQIFDNMPEKNLVSWKAMIVAYAKNGNCGEALKLMYRMQVEGIEV
DDYILATVLTACGEYKETIKSKSKYFLHPNSSXNLNRYESPQEVSAKYNNISSVNDDFVXVSMTAEPECLMLESVDSYSSSAYFWTMMDM
SIAPASPDKEXRYSLSDSAFRGP
Predicted Coding Sequence 
TGTGCAAAGCTGGAAGATATCGAGAGAGGGAAGCTGATCCATTCCTCTATAAGCAAGACACCTGCTCTGTCCAATGTGTTTGTGGGCAGT
GCATTGATCAATATGTATGCAAAATGTGGACATCTTCCTGAGGCAATTCAAATATTTGATAACATGCCTGAGAAGAATTTGGTTTCTTGG
AAGGCGATGATTGTTGCTTATGCTAAAAACGGAAACTGTGGAGAGGCATTGAAGCTCATGTATCGTATGCAAGTAGAGGGCATTGAGGTG
GATGATTATATCCTCGCTACTGTTCTCACAGCATGCGGAGAATATAAGGAAACTATCAAGTCTAAATCGAAGTATTTCTTGCATCCAAAT
AGTTCTXATAACCTAAACAGATATGAGTCTCCTCAAGAAGTTTCAGCGAAATACAATAACATATCCAGTGTAAATGATGATTTCGTCATX
GTCTCAATGACAGCTGAACCTGAGTGCTTAATGTTAGAGTCTGTTGATAGCTATTCGTCATCGGCTTACTTCTGGACCATGATGGACATG
TCTATAGCCCCTGCCTCGCCAGATAAAGAAXTGAGGTACAGTTTATCGGACTCTGCTTTTAGAGGTCCATAA\
Edits in Original Sequence 
(5')TGTGCAAAGCTGGAAGATATCGAGAGAGGGAAGCTGATCCATTCCTCTATAAGCAAGACACCTGCTCTGTCCAATGTGTTTGTGGG
CAGTGCATTGATCAATATGTATGCAAAATGTGGACATCTTCCTGAGGCAATTCAAATATTTGATAACATGCCTGAGAAGAATTTGGTTTC
TTGGAAGGCGATGATTGTTGCTTATGCTAAAAACGGAAACTGTGGAGAGGCATTGAAGCTCATGTATCGTATGCAAGTAGAGGGCATTGA
GGTGGATGATTATATCCTCGCTACTGTTCTCACAGCATGCGGAGAATATAAGGAAACTATCAAGTCTAAATCGAAGTATTTCTTGCATCC
AAATAGTTCTXATAACCTAAACAGATATGAGTCTCCTCAAGAAGTTTCAGCGAAATACAATAACATATCCAGTGTAAATGATGATTTCGT
CATXGTCTCAATGACAGCTGAACtCTGAGTGCTTAATGTTAGAGTCTgGTTGATAGCTATTCGTCATCGGCTTACTTCTGGACCATGATG
GACATGTCTATAGCCCCTGCCTCGCCAGATAAAGAAXTGAGGTACAGTTTATCGGACTCTGCTTTTAGAGGTCCATAA\(3')TATTCGA
ACGTTGTATCTTCTAACCTCAGTGATACTCTGTATTATACGTAGGTTAGGTCCCTACGACTGCGTATTGTCATATTAAGATCATGTATAC
TTGAACTTTTTCTTAGCGAAGTGATAAAGAAAAGGTTATAACAACAACTATGTATACTAAATATTTGAATGTTAAAAATATACTAGTATC
ATTCATGATGTCTTCAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan