ESTScan Details for Unigene SGN-U231742

Score 
294
Direction 
Forward
Predicted Peptide Sequence 
EFTVGAVLNSYCQKGDMEGALGFFSEFKMRGTLPDFLGFMYLVKAYVIKGGWKNLDAFXREMFQSKSVIDLLDRVESEIGTESIRSFLSL
LCEQGSVQEAVNILNEVVTMFFPVREKRADSKDSPCKYKIDIDSRSCESRKLVKASHNCHSQDTQITQFLDFNSYYSCIALLCAKGEYDN
ANEVAKIVTGFRRAYLSLEQIDYFSRYGLSTSSVSSGNKNHAIIQELYWGGKRIGSLT
Predicted Coding Sequence 
XXTGAATTCACTGTCGGTGCAGTACTTAACAGCTATTGTCAGAAGGGTGACATGGAGGGAGCTCTTGGCTTCTTTTCTGAGTTCAAAATG
AGAGGTACACTTCCTGATTTCTTGGGTTTCATGTACTTGGTGAAGGCTTATGTGATAAAGGGAGGATGGAAGAATCTCGATGCATTTXTG
AGGGAGATGTTCCAATCAAAATCTGTCATTGATCTTCTTGATAGAGTTGAAAGTGAAATTGGAACAGAGTCAATTAGAAGTTTTCTTTCT
CTGTTGTGTGAGCAAGGAAGCGTCCAAGAGGCAGTTAATATTCTCAATGAAGTGGTGACCATGTTTTTCCCTGTTAGAGAGAAGAGAGCC
GATTCTAAAGACTCACCCTGCAAATACAAAATAGATATAGACTCCAGGTCATGTGAGAGTCGGAAATTGGTGAAGGCATCACACAACTGT
CATAGTCAAGACACTCAAATAACGCAGTTCCTCGACTTCAATTCTTATTATTCTTGTATTGCTTTATTGTGTGCAAAAGGGGAGTATGAT
AATGCCAATGAAGTGGCAAAAATTGTTACTGGTTTCCGTAGAGCTTATTTGTCTTTAGAACAAATTGACTACTTCTCTAGATATGGTCTG
AGCACTTCTAGTGTTTCTTCCGGGAACAAGAACCATGCAATCATACAAGAGCTCTATTGGGGTGGAAAAAGAATTGGAAGCCTTACX\
Edits in Original Sequence 
(5')XXTGAATTCACTGTCGGTGCAGTACTTAACAGCTATTGTCAGAAGGGTGACATGGAGGGAGCTCTTGGCTTCTTTTCTGAGTTCAA
AATGAGAGGTACACTTCCTGATTTCTTGGGTTTCATGTACTTGGTGAgAGGCTTATGTGATAAAGGGAGGATGGAAGAATCTCGATGCAT
TTXTGAGGGAGATGTTCCAATCAAAATCTGTCATTGATCTTCTTGATAGAGTTGAAAGTGAAATTGGAACAGAGTCAATTAGAAGTTTTC
TTTCTCTGTTGTGTGAGCAAGGAAGCGTCCAAGAGGCAGTTAATATTCTCAATGAAGTGGTGACCATGTTTTTCCCTGTTAGAGAGAAGA
GAGCCGATTCTAAAGACTCACCCTGCAAATACAAAATAGATATAGACTCCAGGTCATGTGAGAGTCGGAAATTGGTGAAGGCATCACACA
ACTGTCATAGTCAAGACACTCAAATAACGCAGTTCCTCGACTTCAATTCTTATTATTCTTGTATTGCTTTATTGTGTGCAAAAGGGGAGT
ATGATAATGCCAATGAAGTGGCAAAAATTGTTACTGGTTTCaCGTAGAGCTTATTTGTCTTTAGAACAAATTGACTAgCTTCTCTAGATA
TGGTCTGAGCACTTCTAGTGTTTCTTgCCGGGAACAAGAACCATGCAATCATACAAGAGCTCTATTGGGGTGGAAAAAGAATTGGAAGCC
TTACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan