ESTScan Details for Unigene SGN-U232034

Score 
530
Direction 
Forward
Predicted Peptide Sequence 
GGSSRARRQRRGEDVXPPAQGFFRGSLQWDIKEAFTISQCVVLKVSIRQLGPSMIQQMQHPCNECKGTGEMISDKDRCPQCKGEKVVQEK
KVLEVHVEKGMQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGEVV
KPDQF
Predicted Coding Sequence 
XGTGGTGGAAGCAGCAGAGCTCGTAGACAAAGAAGAGGAGAGGATGTTXATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACAATGG
GACATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTTTCTATCAGACAGCTCGGTCCATCCATGATCCAGCAGATGCAG
CACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAAGGGTGAGAAGGTTGTGCAGGAG
AAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGAGGCAGATGAAGCGCCAGATACC
ATCACTGGAGACATTGTTTTTGTCTTGCAACAAAAGGAACATCCTAAGTTCAAGCGAAAGGGAGATGATCTTTTTGTTGAGCACACATTG
ACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCACCTAGACAACAGACAGCTGCTCATTAAGTCCCAACCTGGCGAAGTT
GTCAAGCCTGATCAGTTT\
Edits in Original Sequence 
(5')XGTGGTGGAAGCAGCAGAGCTCGTAGACAAAGAAGAGGAGAGGATGTTXATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACA
ATGGGACATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTTTCTATCAGACAGCTCGGTCCATCCATGATCCAGCAGAT
GCAGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAAGGGTGAGAAGGTTGTGCA
GGAGAAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGAGGCAGATGAAGCGCCAGA
TACCATCACTGGAGACATTGTTTTTGTCTTGCAACAAAAGGAACATCCTAAGTTCAAGCGAAAGGGAGATGATCTTTTTGTTGAGCACAC
ATTGACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCACCTAGACAACAGACAGCTGCTCATTAAGTCCCAACCTGGCGA
AGTTGTCAAGCCTGATCAGTTT\(3')TT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan