ESTScan Details for Unigene SGN-U232050

Score 
614
Direction 
Forward
Predicted Peptide Sequence 
MGQQQVQLKRGVDIVVGTPGRIKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILGKVEDASQVQTLLFSATLPSWVKHISSKFL
KPDKKTADLVGDEKMKASKNVRHIIIPCSSSARSQLIPDIIRCYSSGGRTIIFTETRGYASELAGILPGARALHGDIQQSQREITLSGFR
S
Predicted Coding Sequence 
ATGGGACAACAACAAGTTCAACTAAAAAGAGGAGTTGATATCGTCGTAGGTACTCCTGGAAGAATTAAGGACCACATCGAAAGAGGAAAT
ATTGATTTCAGGTCCCTAAAGTTCCGTGTTCTTGATGAAGTTGATGAAATGTTGAAAATTGGTTTTGTTGATGATGTTGAATTTATATTA
GGCAAGGTAGAAGATGCAAGCCAAGTTCAAACACTTCTTTTCAGTGCAACTTTGCCGAGCTGGGTGAAGCATATATCTTCGAAGTTTCTC
AAACCTGATAAGAAAACAGCTGATCTTGTTGGTGATGAGAAAATGAAGGCCAGCAAGAATGTGAGGCATATTATTATACCATGCTCTAGT
TCAGCCAGATCTCAGCTGATTCCTGATATAATTCGCTGCTACAGCAGTGGTGGACGCACAATTATTTTCACTGAGACAAGGGGTTATGCT
TCGGAGCTAGCTGGCATATTGCCTGGGGCACGTGCTTTGCATGGAGACATACAACAATCCCAGCGTGAGATTACACTTTCTGGATTCAGA
TCX\
Edits in Original Sequence 
GGCTAACTTCATGTTGTTTATATGGAAATTCACC(5')ATGGGACAACAACAAGTTCAACTAAAAAGAGGAGTTGATATCGTCGTAGGTA
CTCCTGGAAGAATTAAGGACCACATCGAAAGAGGAAATATTGATTTCAGGTCCCTAAAGTTCCGTGTTCTTGATGAAGTTGATGAAATGT
TGAAAATTGGTTTTGTTGATGATGTTGAATTTATATTAGGCAAGGTAGAAGATGCAAGCCAAGTTCAAACACTTCTTTTCAGTGCAACTT
TGCCGAGCTGGGTGAAGCATATATCTTCGAAGTTTCTCAAACCTGATAAGAAAACAGCTGATCTTGTTGGTGATGAGAAAATGAAGGCCA
GCAAGAATGTGAGGCATATTATTATACCATGCTCTAGTTCAGCCAGATCTCAGCTGATTCCTGATATAATTCGCTGCTACAGCAGTGGTG
GACGCACAATTATTTTCACTGAGACAAGGGGTTATGCTTCGGAGCTAGCTGGCATATTGCCTGGGGCACGTGCTTTGCATGGAGACATAC
AACAATCCCAGCGTGAGATTACACTTTCTGGATTCAGATCX\(3')CAGGAAAGTTCCTTACATTAGTGGCCACAAATGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan