ESTScan Details for Unigene SGN-U232121

Score 
598
Direction 
Forward
Predicted Peptide Sequence 
MENFPIINLEKLNGDERAXHHGNDPRSLGKLGPPLSGGTLEFPLEEWDPEKKLTKELSKNGLEQRFKELWARKELEAVQPEVTDLNWEST
FFLRHLPTSNISQEPDLDKKYKKVMKDFAKKLKKLAEELLDLLCENLGLEKGYLKNAFNGSKGPTFGTKVX
Predicted Coding Sequence 
ATGGAGAACTTCCCAATTATTAACTTGGAAAAGCTCAATGGAGATGAAAGAGCCAAXCACCATGGAAATGATCCAAGAAGCTTGGGAAAA
TTGGGGCCTCCTTTAAGTGGXGGAACCCTGGAATTCCCCCTTGAGGAATGGGACCCGGAAAAAAAATTGACAAAGGAACTTTCCAAAAAT
GGCTTGGAACAAAGGTTTAAGGAACTATGGGCAAGAAAGGAACTTGAGGCTGTCCAACCTGAGGTTACTGATTTAAATTGGGAAAGCACT
TTCTTCTTGCGCCACCTTCCTACTTCTAATATCTCTCAAGAACCCGATCTTGACAAAAAATACAAAAAGGTGATGAAAGATTTTGCTAAA
AAATTGAAGAAATTGGCTGAGGAGTTACTTGACTTACTCTGTGAAAATCTTGGACTTGAAAAAGGTTACTTGAAAAATGCCTTTAATGGA
TCAAAAGGTCCCACCTTTGGTACTAAAGTTAXX\
Edits in Original Sequence 
CTTCAATCTTTTGTATTCACATATTCTATTTATTCAATACACTTAGGAAAACACTTTACCAAGAAATTAA(5')ATGGAGAACTTCCCAA
TTATTAACTTGGAAAAGCTCAATGGAGATGAAAGAGCCAAXCACCATGGAAATGATCCAAGAAGCTTGGGAAAATTGGGGCCTCCTTTAA
GTGGXGGAACCCTGGAATTCCCCCTTGAGGAATGGGACCCGGAAAAAAAATTGACAAAGGAACTTTCCAAAAATGGCTTGGAACAAAGGT
TTAAGGAACTATGGGCAAGAAAGGAACTTGAGGCTGTCCAACCTGAGGTTACTGATTTAAATTGGGAAAGCACTTTCTTCTTGCGCCACC
TTCCTACTTCTAATATCTCTCAAGAACCCGATCTTGACAAAAAATACAAAAAGGTGATGAAAGATTTTGCTAAAAAATTGAAGAAATTGG
CTGAGGAGTTACTTGACTTACTCTGTGAAAATCTTGGACTTGAAAAAGGTTACTTGAAAAATGCCTTTAATGGATCAAAAGGTCCCACCT
TTGGTACTAAAGTTAXX\(3')AGCAACTATCCACCATGTCCTAAGCCCGATTTGATCAAGGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan