ESTScan Details for Unigene SGN-U232127

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
QYKEIVNKVRDASKTWGFFQVVNHGIPTSILEKTLLGTRQFFEQDTEIKKQYYTRDIGEKVIYTSNLDLYSPSVPAASWRDSIFFFMAPN
PPSPQEXSNILREILMDYSKYVTELGFSLLELLSERLGLHRSYLKDYMDFAIKVACAITIHHAX
Predicted Coding Sequence 
CAGTATAAGGAGATTGTGAACAAAGTTCGAGATGCATCTAAAACATGGGGTTTCTTTCAAGTGGTTAATCATGGAATTCCAACATCCATC
TTGGAAAAAACGTTACTAGGAACACGACAGTTTTTCGAGCAAGATACCGAGATCAAGAAACAATATTACACTCGAGATATTGGGGAAAAG
GTGATTTATACTAGCAATCTTGATTTGTATAGCCCTTCTGTTCCAGCTGCAAGTTGGAGAGACTCAATTTTCTTTTTCATGGCTCCGAAT
CCTCCTAGTCCACAAGAAXTTTCCAACATCTTGCGGGAAATTCTAATGGACTACTCCAAGTATGTGACGGAATTGGGGTTCTCCTTGCTT
GAATTATTGTCTGAACGTCTCGGTCTCCATCGTAGTTATCTGAAAGATTATATGGATTTTGCCATCAAAGTTGCTTGTGCCATTACTATC
CATCATGCCCXX\
Edits in Original Sequence 
GGGAACTATCCCTATCTGTCATTTCCTTCCAAATGATCAAATTGTCATATTCCCTTCTAAAGAGGCCACTAATTAAGCTATTATTTGATA
TGATATGTATCATAATAATAGAAATGAAGTTGGGTTCATGGTAAAAAAAACACAAAAAAACAATCAACCAAACAAAAAACAAAAAAAAAA
AAAAGAAAAACACACAAAAAAAAAAACAATAAAAGACCTCGGGGGGGTCCATGACCACCCCAT
(5')CAGTATAAGGAGATTGTGAACAA
AGTTCGAGATGCATCTAAAACATGGGGTTTCTTTCAAGTGGTTAATCATGGAATTCCAACATCCATCTTGGAAAAAACGTTACTAGGAAC
ACGACAGTTTTTCGAGCAAGATACCGAGATCAAGAAACAATATTACACTCGAGATATTGGGGAAAAGGTGATTTATACTAGCAATCTTGA
TTTGTATAGCCCTTCTGTTCCAGCTGCAAGTTGGAGAGACTCAATTTTCTTTTTCATGGCTCCGAATCCTCCTAGTCCACAAGAAXTTTC
CAACATCTTGCGGGAAATTCTAATGGACTACTCCAAGTATGTGACGGAATTGGGGTTCTCCTTGCTTGAATTATTGTCTGAACGTCTCGG
TCTCCATCGTAGTTATCTGAAAGATTATATGGATTaTTGCCATCAAAGTTGCTTGTGCCATTACTATCCATCATGCCCXX\(3')CCTCA
ACCAGAACTCACCATGGGCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan