ESTScan Details for Unigene SGN-U232155

Score 
816
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIA
VKFAEILTKIDRR
Predicted Coding Sequence 
ATGGGTAAAGAGAAGATTCACATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTT
GACAAACTTAAGGCAGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTTATT
GATGCCCCTACTGGTTTGACAACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGG
TTCAATGTTAAGAATGTTGCTGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGC
TTCACTGCCCAGGTCATCATCATGAACCATCCTGGCCAGATTGGAAACGGATATGCCCCTGTGCTCGACTGTCACACTTCACACATTGCT
GTCAAGTTTGCTGAGATCTTGACCAAGATTGACAGGCGT\
Edits in Original Sequence 
GGTTATTTCTCCTCAGCTGTGCCGCATATCGCCTAATTTTTCTTCTCTAAGTTTCTTAGTGTCTCA(5')ATGGGTAAAGAGAAGATTCA
CATCAGCATCGTGGTCATTGGTCATGTTGACTCTGGAAAGTCGACTACCACTGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCG
TGTTATTGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCAGAACG
TGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTTATTGATGCCCCTACTGGTTTGAC
AACTGAAGTCAAGTCTGTAGAGATGCACCACGAAGCTCTCCAGGAGGCACTCCCTGGTGACAATGTTGGGTTCAATGTTAAGAATGTTGC
TGTTAAGGATCTTAAGCGTGGTTATGTTGCCTCAAACTCCAAGGATGACCCAGCCAAGGGGGCAGCCAGCTTCACTGCCCAGGTCATCAT
CATGAACCATCCTGGCCAGATTGGAAACGGATATGCCCCTGTGCTCGACTGTCACACTTCACACATTGCTGTCAAGTTTGCTGAGATCTT
GACCAAGATTGACAGGCGT\(3')GT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan