ESTScan Details for Unigene SGN-U232157

Score 
266
Direction 
Reverse
Predicted Peptide Sequence 
NPPGQIGNGYAPVFDCHTSPIAVKFAEILTKIDRRFGKELGKGPKFLKNGDAGMVKMIPPKPRVVGPFGGSPPLGRFAVGDMGQTVAVGV
VKNVDKKDPMGAKVPKAAQKKKGWVFEGILH
Predicted Coding Sequence 
AACCCCCCTGGTCAGATTGGAAACGGATATGCCCCAGTGTTTGATTGCCACACCTCCCCCATTGCGGTCAAGTTTGCGGAGATTTTGACC
AAGATTGACAGACGTTTTGGTAAGGAACTTGGGAAGGGGCCCAAGTTTTTGAAAAATGGGGATGCCGGTATGGTTAAAATGATTCCCCCC
AAGCCCAGGGTTGTTGGGCCCTTTGGTGGGTCCCCCCCATTGGGGCGTTTTGCCGTGGGGGACATGGGTCAGACTGTTGCTGTTGGGGTT
GTCAAGAACGTTGACAAGAAAGACCCTATGGGGGCTAAAGTCCCCAAGGCTGCCCAAAAGAAGAAGGGATGGGTTTTTGAGGGGATTTTG
CATTGA\
Edits in Original Sequence 
(5')AACCCCCCTGGTCAGATTGGAAACGGATATGCCCCAGTGTTTGATTGCCACACCTCCCCCATTGCGGTCAAGTTTGCGGAGATTTT
GACCAAGATTGACAGACGTTTTGGTAAGGAACTTGGGAAGGGGCCCAAGTTTTTGAAAAATGGGGATGCCGGTATGGTTAAAATGATTCC
CCCCAAGCCCAGGGTTGTTGGGCCCTTTGGTGGGTCCCCCCCATTGGGGCGTTTTGCCGTGGGGGACATGGGTCAGACTGTTGCTGTTGG
GGTTGTCAAGAACGTTGACAAGAAAGACCCTATGGGGGCTAAAGTCCCCAAGGCTGCCCAAAAGAAGAAGGGATGGGTTTTTGAGGGGAT
TTTGCATTGA\(3')GGAACTAGTTTTGTTTAATTGCATTAGCTATTTTCAATTTTGTTTTGAACATTTTCCCAGTCATAGATTTGGCTC
CAGAAGCTTTTGTCAGGGTTTTTTAGCCTTTTTTGGGGATAGGGGGGTTTTTGGGCAATTTGGTTTGATCCAAGTTGCTTGATGAGGTGG
GACAAAAGCATTTTGGAGGCCTTTTTACTTTTGGGTTTTTAAAGGGAATTCCCAGATAAGAGGTTGGGGGGGTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan