ESTScan Details for Unigene SGN-U232164

Score 
45
Direction 
Reverse
Predicted Peptide Sequence 
IEITVXLRQFFAGCSLYLPLNGQNMLQSHEFFYMVVI
Predicted Coding Sequence 
ATTGAAATAACAGTTXCTCTGCGTCAATTTTTTGCTGGATGTAGTTTGTATCTTCCCCTCAACGGCCAGAATATGTTGCAATCCCATGAG
TTCTTCTACATGGTTGTAATTTGA\
Edits in Original Sequence 
(5')ATTGAAATAACAGTTXCTCTGCGTCAATTTTTTGCTGGATGTAGTTTGTATCTTCCCCTCAACGGCCAGAATATGTTGCAATCCCA
TGAGTTCTTCTACATGGTTGTAATTTGA\(3')TTTAATGAGCAGTCGGATAGGAAATTCAGCAATCTAGTGATGTCTTACCTTAGGCTG
TTTGCTTTTCGCTAATGAATGTACCATACTTTTGGTTTTAACATATGCTAGTATGCAGGGTTGCAAAGATGTTGTGTTTTCCTTGTGCGA
TTTCTAGTCTCTGTAGGAGTAATTTTATATTGCAGAGTGCATGATTATCTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan