ESTScan Details for Unigene SGN-U232263

Score 
117
Direction 
Reverse
Predicted Peptide Sequence 
VFTPXIVDLLGVFQEFPIVLFNLKSFFLKSSSKGLGAQLHLGNAGCDDR
Predicted Coding Sequence 
XCTGTCTTCACGCCGTTXATCGTTGACCTACTTGGAGTTTTTCAAGAGTTTCCTATTGTATTGTTCAACTTGAAGAGTTTCTTTTTGAAA
TCGAGTTCTAAGGGACTTGGTGCTCAGCTCCATTTGGGCAATGCAGGATGTGATGATAGATGA\
Edits in Original Sequence 
(5')XCTGTCTTCACGCCGTTXATCGTTGACCTACTTGGAGTTTTTCAAGAGTTTCCTATTGTATTGTTCAACTTGAAGAGTTTCTTTTT
GAAATCGAGTTCTAAGGGACTTGGTaGCTCAGCTCCATTTGGGCAATGCAGGATGTGATGATAGATGA\(3')CTGCCATACTGTTACAT
TTATTTGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan