ESTScan Details for Unigene SGN-U232298

Score 
168
Direction 
Forward
Predicted Peptide Sequence 
MDVVVLIHLPSSGIIQXFGDVLILSPDYLLDPAYYVLKEDTSPCIFGPIEKQRWSYACAKQLIX
Predicted Coding Sequence 
ATGGATGTTGTAGTGCTCATTCATTTACCATCTTCTGGTATTATTCAAXATTTTGGAGATGTTTTAATTCTTTCTCCTGATTATCTCTTG
GATCCTGCATACTATGTGCTTAAGGAAGACACCTCCCCTTGCATTTTTGGACCTATTGAGAAGCAGAGGTGGTCATATGCCTGTGCAAAG
CAATTGATTGXX\
Edits in Original Sequence 
GTTCTTTTAGGTAGCTTTAACTTGTTCAATGAAGCATCTTTTTTCCTCTTAAAATAAAACTTAAGGAAGTGGTTGATACTTAACATTTGT
GTGCTTATGTATTTGTAATCCTCTGTGATACGCAGTTCTTGGGAGTTTTGAGTAATTGCTAAGTGATTAACAACTGAAAACAATGTGTGT
GTTTTTGTATGTTGCATGGATTATCATGTAGGTTGAATTTTAGTAGTAACTCTATGGTTACTTGTATTGTAAAA
(5')ATGGATGTTGTA
GTGCTCATTCATTTACCATCTTCTGGTATTATTCAAXATTTTGGAGATGTTTTAATTCTTTCTCCTGATTATCTCTTaGGATCCTGCATA
CTATGTGCTTAAGGAAGACACCTCCCCTTGCATTTTTGGACCTATTGAGAAGCAGAGGTGGTCATATGCCTGTGCAAAGCAATTGATTGX
X\(3')TGAGAGGTTGATATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan