ESTScan Details for Unigene SGN-U232452

Score 
231
Direction 
Forward
Predicted Peptide Sequence 
HVEGQNLYDSAAKLRLPDFPAFALECIPNRNSLVYGDLYGISEEASTIFRGTLRYEGFSQIMGTLVKIGFFSTESTLILKDGIRPTTAXF
LLGLLGIDGKMLPESVIDEKYITNRILALGRCTDKDTAXQYSKNNNVS
Predicted Coding Sequence 
XXCCATGTCGAAGGTCAGAACCTTTATGATTCAGCTGCAAAGCTTCGTCTTCCTGATTTTCCAGCCTTTGCATTAGAGTGTATACCAAAT
CGCAACTCCTTAGTGTATGGAGACTTGTATGGTATATCAGAAGAAGCATCTACCATCTTCCGAGGAACACTACGCTATGAAGGTTTTAGT
CAAATAATGGGGACACTTGTGAAGATAGGATTCTTCAGTACAGAATCTACTCTGATTCTTAAGGATGGGATCAGACCCACCACAGCACXG
TTTTTGCTTGGACTTCTTGGGATCGATGGAAAGATGTTGCCTGAATCAGTAATTGATGAAAAATACATCACAAATAGGATATTAGCTCTT
GGGCGTTGCACAGACAAGGACACTGCAGXTCAATACAGCAAAAACAATAATGTAAGTTGA\
Edits in Original Sequence 
(5')XXCCATGTCGAAGGTCAGAACCTTTATGATTCAGCTGCAAAGCTTCGTCTTCCTGATTTTCCAGCCTTTGCATTAGAGTGTATACC
AAATCGCAACTCCTTAGTGTATGGAGACTTGTATGGTATATCAGAAGAAGCATCTACCATCTTCCGAGGAACACTACGCTATGAAGGTTT
TAGTCAAATAATGGGGACACTTGTGAAGATAGGATTCTTCAGTACAGAATCTACTCTGATTCTTAAGGATGGGATCAGACCCACgCACAG
CACXGTTTTTGCTTGGACTTCTTGGGATCGATGGAAAGATGTTGCCTGAATCAGTAATTGATGAAAAATACATCACAAATAGGATATTAG
CTCTTGGGCGTTGCACAGACAAGGACACTGCAGXTCAATACAGCAAAAACAATAATGTAAGTTGA\(3')AACGACTATTTAAGGTCAAT
CAGTTCTACTTGAAGCATTGAACAAGTATGTTCTTTAAAGCGAATATGTTGGTATAAAATGTTAAGTATTGTTTGTTATTCGTAAGAAAC
ATGTTTTGGTTGAATGATAAAGAGTTTACTTAATATCCAAATAGCTTTTTGGGATTCCAAGAGCCCACGGAAATACCATCATCCTGCAAA
TCTCCATTTGAAGTAACATGTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan