ESTScan Details for Unigene SGN-U232460

Score 
664
Direction 
Forward
Predicted Peptide Sequence 
YADYFSFFLKLTTRLYPTIFSNVXFQKGREFLKAEGGEETTFPRSSASSNSSSATSSKDEENRMPLLALNHVSYVCKSVPKSAQFYEQVL
GFVLIKRPSSFDFDGAWLFNHGIGIHLLGKEDVQSKRGKINPKDNHISFQCTDMDLIIQRLNDMNVEYVTATVKEGGVTVDQLFFHDPDG
NMIEICNCQNLPVLPLSSCPLKKMSSPTFNQTMSDSFYGNGKTNTKMNCSGEVESLMMENLALDM
Predicted Coding Sequence 
TATGCTGATTATTTTTCCTTTTTTCTTAAGCTAACTACGAGATTATATCCCACCATTTTCTCAAATGTTXTTTTTCAAAAGGGAAGAGAA
TTTTTGAAAGCAGAAGGGGGGGAGGAAACAACCTTCCCCCGGTCATCAGCATCATCAAATTCATCATCCGCAACATCTTCAAAAGATGAA
GAAAACAGAATGCCTCTGTTAGCATTGAATCATGTTTCTTATGTCTGCAAATCTGTTCCTAAATCTGCCCAATTTTATGAACAAGTCCTC
GGTTTCGTACTAATCAAACGTCCATCCTCCTTTGATTTTGATGGTGCTTGGTTATTCAACCATGGAATTGGAATTCATTTGTTAGGAAAA
GAAGATGTGCAATCAAAAAGGGGAAAAATTAACCCAAAAGATAATCACATTTCATTTCAGTGCACAGATATGGATCTTATTATTCAGAGA
TTGAATGATATGAATGTTGAATATGTAACTGCTACTGTTAAAGAAGGTGGAGTTACAGTGGATCAACTCTTTTTTCATGACCCAGATGGC
AATATGATTGAAATTTGCAATTGTCAGAATTTACCTGTTCTTCCACTTTCTTCTTGCCCACTCAAAAAAATGTCAAGTCCAACTTTCAAC
CAAACAATGTCAGATTCCTTTTATGGAAATGGAAAAACAAATACAAAGATGAATTGTTCAGGAGAAGTTGAATCTCTTATGATGGAAAAT
TTAGCTCTGGATATG\
Edits in Original Sequence 
(5')TATGCTGATTATTTTTCCTTTTTTCTTAAGCTAACTACGAGATTATATCCCACCATTTTCTCAAATGTTXTTTTTCAAAAGGGAAG
AGAATTTTTGAAAGCAGAAGGGGGGGAGGAAACAACCTTCCCCCGGTCATCAGCATCATCAAATTCATCATCCGCAACATCTTCAAAAGA
TGAAGAAAACAGAATGCCTCTGTTAGCATTGAATCATGTTTCTTATGTCTGCAAATCTGTTCCTAAATCTGCCCAATTTTATGAACAAGT
CCTCGGTTTCGTACTAATCAAACGTCCATCCTCCTTTGATTTTGATGGTGCTTGGTTATTCAACCATGGAATTGGAATTCATTTGTTAGG
AAAAGAAGATGTGCAATCAAAAAGGGGAAAAATTAACCCAAAAGATAATCACATTTCATTTCAGTGCACAGATATGGATCTTATTATTCA
GAGATTGAATGATATGAATGTTGAATATGTAACTGCTACTGTTAAAGAAGGTGGAGTTACAGTGGATCAACTCTTTTTTCATGACCCAGA
TGGCAATATGATTGAAATTTGCAATTGTCAGAATTTACCTGTTCTTCCACTTTCTTCTTGCCCACTCAAAAAAATGTCAAGTCCAACTTT
CAACCAAACAATGTCAGATTCCTTTTATGGAAATGGAAAAACAAATACAAAGATGAATTGTTCAGGAGAAGTTGAATCTCTTATGATGGA
AAATTTAGCTCTGGATATG\(3')CATCATTATTAGCTCTTTTATTTATTTTTTTACCACCCCAATATAACATAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan