Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U232573

Score 
135
Direction 
Reverse
Predicted Peptide Sequence 
GIPFGGSQMSGMGREKGIFSLNNYLQVKAVVTPLKNPAW
Predicted Coding Sequence 
XCTGGAATTCCTTTTGGAGGGTCACAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTTCAGCCTTAACAACTACTTACAAGTAAAGGCT
GTTGTTACTCCATTGAAGAATCCAGCTTGG\
Edits in Original Sequence 
(5')XCTGGAATTCCTTTTGGAGGGTCACAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTTCAGCCTTAACAACTACTTACAAGTAAA
GGCTGTTGTTACTCCATTGAAGAATCCAGCTTGG\(3')TACTCCATTGAAGAATCCAGCTTGGATATAGATTGGGCACCCCTGATTTTA
AAATCATAGTACTACTGTTTTTGTAAAATGACATGGTTGTTTACATGACATTGTTGTTAGCAATCAATAAAGTCTTCATTTGGTTGTTGT
CCTGTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan