ESTScan Details for Unigene SGN-U232574

Score 
204
Direction 
Reverse
Predicted Peptide Sequence 
MDNNKHPDPRIESLNEXGLNDXDIFDAGIPFGGYKMSGMGREKGIYSLNKYLQVKAVVTPLKNPAW
Predicted Coding Sequence 
ATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAXAGATATATTTGATGCTGGAATTCCT
TTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTTACAAGTGAAGGCTGTTGTTACTCCA
TTGAAGAATCCAGCTTGG\
Edits in Original Sequence 
AAAAAAAAATTTCCACCCCTC(5')ATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAX
AGATATATTTGATGCTGGAATTCCTTTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTT
ACAAGTGAAGGCTGTTGTTACTCCATTGAAGAATCCAGCTTGG\(3')ATATAGATTGGGCACCCCTGATTTTAAAATCATAGTACTACT
GTTTTTGTAAAATGACATGGTTGTTTACATGACATTGTTAGGGGCAATCAATAAAGTTTTCATTTGGTTGTTGTTTTGTAGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan