Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U232700

Score 
272
Direction 
Reverse
Predicted Peptide Sequence 
GVVGTPYYVAPEVLMGKEYNEKVDVWSLGVILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS
AEQVLRHPWVLNGGETRSMVD
Predicted Coding Sequence 
XXTGGGGTTGTGGGTACGCCGTATTACGTTGCGCCGGAGGTTTTAATGGGGAAAGAGTATAATGAGAAAGTTGATGTGTGGAGTTTGGGG
GTTATTTTGTATATTATGCTTTCTGGGGTTCCTCCTTTTTACGGTGAAACGCCGACTGAAACTTTTCAAGCTGTTCTCAGAGGGAATCTG
AGGTTTCCGACGAGGAATTTCCGGTCAGTTTCGCCTGAAGCGAAAGATTTGTTGAGGAAGATGATATGTAAAGATGTTTCCAGAAGATTT
TCAGCTGAACAAGTATTGAGACATCCATGGGTGCTTAATGGAGGAGAAACAAGATCAATGGTTGATTGA\
Edits in Original Sequence 
(5')XXTGGGGTTGTGGGTACGCCGTATTACGTTGCGCCGGAGGTTTTAATGGGGAAAGAGTATAATGAGAAAGTTGATGTGTGGAGTTT
GGGGGTTATTTTGTATATTATGCTTTCTGGGGTTCCTCCTTTTTACGGTGAAACGCCGACTGAAACTTTTCAAGCTGTTCTCAGAGGGAA
TCTGAGGTTTCCGACGAGGAATTTCCGGTCAGTTTCGCCTGAAGCGAAAGATTTGTTGAGGAAGATGATATGTAAAGATGTTTCCAGAAG
ATTTTCAGCTGAACAAGTATTGAGACATCCATGGGTGCTTAATGGAGGAGAAACAAGATCAATGGTTGATTGA\(3')ACTTGAACAAGA
TACTAATAAATACTAGTAGCAGTACAAATTTTGATGATAAAAAAGCTTCTTTTAATGTGTTTGTTTGTGTATATTGCACCAAAAAAATAA
AAATAAAATTATGGTTTGTTATGTTGTGGAGAAGAATCTTGTAGATGATAATGAATCTCCTACTTTATATTATAATATAACAAGAAGAAA
AAAAATTTCAGGCTATATAAAAAGATCCAAGCTTACCCCACCTTTATATTTATTATTATTATTTTTAATTATAAAGGGTTGAGGGAGAGA
GGGATATATGTATGTTTTGGTGCTGTATCAAAGTTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan