ESTScan Details for Unigene SGN-U232895

Score 
607
Direction 
Forward
Predicted Peptide Sequence 
MGSSGGIDYGSYTYENLEREPYWPSEKLRISITGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLADLRVMDNCLKVTK
GSSMHLAACIYPEFKQLETNVSLKEADAWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQ
TATDKFEMWGDGLQTRSFX
Predicted Coding Sequence 
ATGGGAAGCTCTGGTGGTATTGACTATGGTTCTTACACTTATGAGAATCTTGAGAGGGAACCTTACTGGCCGTCTGAGAAGCTCCGTATT
TCCATTACTGGGGCTGGAGGGTTTATCGCTTCTCACATTGCTCGCCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCTGATTGGAAG
AAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAA
GGTTCTTCTATGCATCTAGCXGCTTGCATATACCCTGAGTTCAAACAACTTGAAACAAATGTCAGCCTGAAAGAAGCTGATGCATGGCCT
GCAGAGCCTCAAGATGCATATGGTTTGGAGAAGCTTGCCACAGAAGAATTGTGCAAACATTACAACAAGGATTTTGGAATTGAATGTCGT
ATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACCTGGAAAGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGTAGAAAAGCACAA
ACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAAACACGTTCATTCAXX\
Edits in Original Sequence 
GCTTTCTAATATCTCAATCTTTTTCTCCTCCATACTTTTACA(5')ATGGGAAGCTCTGGTGGTATTGACTATGGTTCTTACACTTATGA
GAATCTTGAGAGGGAACCTTACTGGCCGTCTGAGAAGCTCCGTATTTCCATTACTGGGGCTGGAGGGTTTATCGCTTCTCACATTGCTCG
CCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCTGATTGGAAGAAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCA
TCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAAGGTTCTTCTATGCATCTAGCXGCTTGCATATACCCTGAGTTCAA
ACAACTTGAAACAAATGTCAGCCTGAAAGAAGCTGATGCATGGCCTGCAGAGCCTCAAGATGCATATGGTTTGGAGAAGCTTGCCACAGA
AGAATTGTGCAAACATTACAACAAGGATTTTGGAATTGAATGTCGTATTGGAAGGTTCCATAACATCTATGGACCTTTTGGAACCTGGAA
AGGTGGAAGGGAAAAAGCTCCTGCCGCTTTTTGTAGAAAAGCACAAACTGCAACGGATAAGTTTGAAATGTGGGGAGATGGACTTCAAAC
ACGTTCATTCAXX\(3')CA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan