ESTScan Details for Unigene SGN-U232938

Score 
158
Direction 
Forward
Predicted Peptide Sequence 
MNFSRPEGKRTVEKANEILVQESNVQPVISPVTICGDIHGQIHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLVALKVXLSPT
NYYPKVKSWSRQITQVYGFYDECX
Predicted Coding Sequence 
ATGAATTTCAGCAGGCCAGAAGGTAAGAGGACTGTGGAGAAAGCCAACGAGATTCTAGTGCAAGAGAGTAATGTGCAGCCTGTGATAAGC
CCTGTGACGATATGTGGTGATATTCATGGGCAGATCCATGATCTTGCTGAGCTTTTTCGAATTGGTGGGAAGTGTCCTGACACTAATTAT
TTATTCATGGGAGATTATGTGGATCGTGGATACTATTCTGTCGAAACAGTCTCGCTTTTGGTGGCTCTCAAAGTTCXGCTATCCCCAACG
AATTACTATCCTAAGGTGAAATCATGGAGTCGTCAGATTACTCAGGTTTATGGGTTTTATGATGAATGCCXX\
Edits in Original Sequence 
CCGAGCGAGCGGGAATTTTCTCTCTCCATGCGGAGCTGAGAGAAAATCAAAAGCAAATCTTACCTCCATTATGATTTCTTCCTCCTTTTT
TGCTGTCAACAAAATCTATGGTTTCTGCCGTGGAGTTTGAAGAAAGTTTCCTCATCTCTGTTGTCTGTTTCTTCCAGTTCCCTCAAGTAG
TAGAAGAAGATCACCATGGATTCGGTATGAAATCTTGATGAAAAAATTGGTCTGCTTATGCAGTGCAAACCCTTGTCCGAGCAGGCGATT
TTTACATAGGATTCCCCATCCTCCTCTGAGAAAAGAAAGCAAAAACAGAACAAATCACTTTTTTCCAGTAAAATAGGATTTGGAGAGCTT
TCACGATCGTTCACA
(5')ATGAATTTCAGCAGGCCAGAAGGTAAGAGGACTGTGcGAGAAAGCCAACGAGATTCTAGTGCAAGAGAGTA
ATGTGCAGCCTGTGATAAGCCCTGTGACGATATGTGGTGATATTCATGGGCAGATCCATGATCTTGCTGAGCTTTTTCGAATTGGTGGGA
AGTGTCCTGACACTAATTATTTATTCATGGGAGATTATGTGGATCGTGGATACTATTCTGTCGAAACAGTCTCGCTTTTGGTGGCTCTCA
AAGTTCXGCTATCCCCAACGAATTACTATCCTAAGGTGAAATCATGaGAGTCGTCAGATTACTCAGGTTTATGGGTTTTATGATGAATGC
CXX\(3')ACGAAAATATGGTAATGCCGATGTGTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan