ESTScan Details for Unigene SGN-U232962

Score 
73
Direction 
Forward
Predicted Peptide Sequence 
MGPTRIVEARHCESLSHRFKGPCVRIRIVPRFARPKDFPVVIAVDSVAVAFAPSHAK
Predicted Coding Sequence 
ATGGGACCAACGAGAATCGTAGAGGCAAGACATTGTGAGTCGTTGAGCCATCGTTTCAAGGGACCATGTGTGAGGATAAGAATTGTGCCT
CGGTTTGCGAGACCGAAAGATTTTCCGGTGGTAATTGCCGTGGATTCCGTCGCCGTTGCTTTTGCACCAAGCCATGCTAAATAA\
Edits in Original Sequence 
AGAAGTTGGTTTTTATAATATTCAAATTAAAAATTTAGTAACATTCATTTCGAAACAGATTAAAAAAATAATAATGCGTATAAATTGCAA
AGTAGAGAGTATCACGCTTTGATTTGTTGTTTAAAGTAACTCGTACGTAACTAATATGATTTTATTTTCACAGAA
(5')ATGGGACCAAC
GAGAATCGTAGAGGCAAGACATTGTGAGTCGTTGAGCCATCGTTTCAAGGGACCATGTGTGAGcGATAAGAATTGTGCCTCGGTTTGCGA
GACCGAAAGATTTTCCGGTGGTAATTGCCGTGGATTCCGTCGCCGTTGCTTTTGCACCAAGCCATGCTAAATAA\(3')ATAATTTTGAT
TTTTATGTGTAAAAGAAGAAGTTTGAGAAGAAAAAAAATATTATGTAATTTTGAATAAAGATGTATTGTAATGCTAGTTTTGTTTGTAAA
AACTAGTTGTGATCTTTGAATTTGTATGCAATTATGGTGCACTAGACTTGTAATTCTTCATGTGGGGTATTTTTATTTTTATTTTTGAAA
TATTATAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan