ESTScan Details for Unigene SGN-U233040

Score 
148
Direction 
Forward
Predicted Peptide Sequence 
MPSHADVDRQIEQLMECKPLSEAEVKTLCEQARADTSGGMECATGEMSGDGGGDIHGQFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYS
VETVSLLVALKVRYTEESQFLGETMKADRSLKXYGFYDECLKKYGNANX
Predicted Coding Sequence 
ATGCCGTCGCACGCGGATGTAGATCGGCAGATCGAGCAATTGATGGAGTGCAAGCCGTTATCGGAGGCGGAGGTGAAGACGTTGTGTGAA
CAAGCAAGGGCXGATACTAGTGGAGGAATGGAATGTGCAACCGGTGAAATGTCCGGTGACGGTGGCGGTGATATCCATGGACAGTTTTAC
GATCTGATTGAGCTTTTTCGAATCGGCGGCAACGCTCCTGATACTAATTATCTCTTCATGGGAGATTATGTTGACCGTGGATACTATTCT
GTCGAGACTGTCTCACTATTGGTTGCTTTGAAGGTTCGTTATACAGAAGAATCACAATTCTTAGGGGAAACCATGAAAGCCGACAGATCA
CTCAAGXTGTATGGTTTTTATGATGAATGTTTGAAGAAGTATGGAAATGCCAATGXX\
Edits in Original Sequence 
GGAGAAGCTTCTCATGAATGGAGACGAATTTCAGAAACAGGAGATGATTCAGAGATTGAAACCCTAGTTTCTTCATCAATGTTCCAATCG
TTAATTTCTGTTTGATTTTAATCTTCGGCGTGCAAAAACTCCGATTCTGTTGGTCAATTTCATAGCAATTGGATTTTACCTCGATTCGAT
CTGAGGACTTTTGGGTCTTTTTTTGCTAATCGAAGCGGTGAGGAATATTTAGGCAGGTGATTGTAGAGGATAATTTTGTTTGAAA
(5')A
TGCCGTCGCACGCGGATGTAGATCGGCAGATCGAGCAATTGATGGAGTGCAAGCCGTTATCGGAGGCGGAGGTGAAGACGTTGTGTGAAC
AAGCAAGGGCXGATACTAGTGGAGGAATGGAATGTGCAACCGGTGAAATGTCCGGTGACGGTGtGCGGTGATATCCATGGACAGTTTTAC
GATCTGATTGAGCTTTTTCGAATCGGCGGCAACGCTCCTGATACTAATTATCTCTTCATGGGAGATTATGTTGACCGTGGATACTATTCT
GTCGAGACTGTCTCACTATTGGTTGCTTTGAAGGTTCGTTATACAGAtAGAATCACAATTCTTAGGGGAAACCATGAAAGCCGACAGATC
ACTCAAGXTGTATGGTTTTTATGATGAATGTTTGAAGAAGTATGGAAATGCCAATGXX\(3')TGTTTTGAAATATTTCACTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan