ESTScan Details for Unigene SGN-U233122

Score 
130
Direction 
Forward
Predicted Peptide Sequence 
LDEQISSLCRKPLSEPEVRALCEKAXGDPNGRKNVQPVKSPELYXGDIHGQFHDLAELFRIGGQCPDTNYLFMGDY
Predicted Coding Sequence 
CTGGATGAGCAGATTTCTAGCTTATGCAGGAAGCCTCTATCTGAGCCTGAGGTTAGAGCATTATGTGAGAAGGCTAAXGGAGATCCTAAT
GGAAGAAAGAATGTTCAGCCAGTAAAAAGCCCTGAACTATATGXTGGTGATATTCATGGGCAGTTCCATGATCTTGCTGAACTTTTTAGG
ATTGGTGGACAGTGTCCAGATACAAATTATCTGTTTATGGGTGATTAC\
Edits in Original Sequence 
GGAAAATTGATTCTTGAGTTGAAATTTTTTTTTGAAGATAGTTGTACGAAATGAGGGGGATTTGAAGCTAACACACATCGAACCTGGATG
AG
(5')CTGGATGAGCAGATTTCTAGCTTATGCAGGAAGCCTCTATCTGAGCCTGAGGTTAGAGCATTATGTGAGAAGGCTAAXGGAGAT
CCTAATGGAAGAAAGAATGTTCAGCCAGTAAAAAGCCCTGAACTATATGXTGGTGATATTCATGGGCAGTTCCATGATCTTGCTGAACTT
TTTAGGATTGGTGGACAGTGTCCAGATACAAATTATCTGTTTATGGGTGATTAC\(3')GGATATTATTCGGTTGAAACAGTTACGCTAT
TGGTAGCTCTGAAAGTGCGTTATCCTCAACGACTAACAATTCTTAGAGGAAATCATGACAGCCGACAGATCACACAAGTCTATGGGTTCT
ATGATGAATGGTTGCGGAAGTATGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan