ESTScan Details for Unigene SGN-U233207

Score 
95
Direction 
Forward
Predicted Peptide Sequence 
TNLLHLPALTPSRTTVKPAAKETEKMPGIKGPSDYSREPPRHPSLKINAXGKINIKGYALSGGGXWHIKGRRVYDGGKTWEEATRYQRTG
VPYIADDSSSDRWAWVFFEA
Predicted Coding Sequence 
XXTACAAATCTTCTTCATCTACCTGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGGATT
AAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGGGGTACGCA
TTATCAGGAGGTGGGCXGTGGCATATAAAGGGTAGACGTGTCTATGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGAACT
GGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCT\
Edits in Original Sequence 
(5')XXTACAAATCTTCTTCATCTACCTcGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTG
GGATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGGGGT
ACGCATTATCAGGAGGTGGGCXGTGGCATATAAAGGGTAGACGTGTCTATaGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAG
AGAACTGGTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCT\(3')AGCTGAGGCAGATATT
CCCCACAGTGCGGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan