ESTScan Details for Unigene SGN-U233222

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
MGEKKEETIAQVAEKKNDAGEKKSGGGDTVAAGGKKDAGPTAIVLKLDFIVKAVPKKSNVPFAISKXVEDAKTDCDSGKLTVKGNADPAW
VRGKVAMKTKKTGGRVSPQPLKDTGAGARGGDKKPVEKKAEEKKT
Predicted Coding Sequence 
ATGGGTGAGAAAAAAGAAGAAACTATAGCACAGGTGGCAGAGAAGAAGAATGACGCCGGAGAAAAAAAGTCCGGCGGCGGTGACACTGTC
GCCGCCGGTGGAAAAAAGGATGCCGGTCCTACCGCCATAGTTTTAAAACTCGATTTCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTT
CCATTTGCCATCTCTAAAGXTGTGGAGGACGCGAAGACAGACTGTGACAGTGGAAAATTGACTGTGAAAGGGAACGCGGATCCGGCATGG
GTCCGCGGGAAAGTAGCGATGAAAACAAAAAAAACAGGGGGGCGCGTTTCTCCTCAGCCTCTAAAGGACACCGGCGCCGGCGCCCGCGGT
GGAGATAAAAAACCCGTTGAGAAAAAGGCGGAAGAGAAAAAAACX\
Edits in Original Sequence 
GCCTATAATTTCTCTATAATCCATTTTCATTTTATC(5')ATGGGTGAGAAAAAAGAAGAAACTATAGCACAGGTGGCAGAGAAGAAGAA
TGACGCCGGAGAAAAAAAGTCCGGCGGCGGTGACACTGTCGCCGCCGGTGGAAAAAAGGATGCCGGTCCTACCGCCATAGTTTTAAAACT
CGATTTgCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTCCATTTGCCATCTCTAAAGXTGTGGAGGACGCGAAGACAGACTGTGACA
GTGGAAAATTGACTGTGAAAGGGAACGCGGATCCGGCATGGGTCCGCGGGAAAGTAGCGATGAAAACAAAAAAAACAGGGGGGCGCGTTT
CTCCTCAGCCTCTAAAGGACACCGGCGCCGGCGCCCGCGGTGGAGATAAAAAACCCGTTGAGAAAAAGGCGGAAGAGAAAAAAACX\(3')
AC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan