ESTScan Details for Unigene SGN-U233229

Score 
307
Direction 
Forward
Predicted Peptide Sequence 
LNDRVXNQVAEVEEKTSGGLFLSQAAKEKPSFGAVIAVGPGPLDEEGKRKALSVSPGNTVLYSKYAGNDFKGADGSEYITLRASDVIAVL
Q
Predicted Coding Sequence 
TTGAATGACAGAGTTXCTAATCAGGTGGCTGAAGTTGAGGAAAAAACTTCTGGGGGATTGTTTTTGAGCCAGGCTGCAAAGGAGAAACCT
TCATTTGGCGCGGTGATAGCTGTTGGACCCGGTCCTCTCGACGAGGAAGGGAAAAGGAAAGCACTTTCAGTATCTCCTGGAAATACAGTT
TTGTATTCCAAATATGCTGGCAATGACTTCAAAGGAGCTGATGGTTCTGAATACATCACATTGAGGGCATCTGATGTAATTGCTGTGCTT
CAGTAA\
Edits in Original Sequence 
(5')TTGAATGACAGAGTTXCTAATCtAGGTGGCTGAAGTTGAGGAAAAAACTTCTGGGGGATTGTTTTTGAGCCAGGCTGCAAAGGAGA
AACCTTCATTTGGCGCGGTGATAGCTGTTGGACCCGGTCCTCTCGACGAGGAAGGGAAAAGGAAAGCACTTTCAGTATCTCCTGGAAATA
CAGTTTTGTATTCCAAATATGCTGGCAATGACTTCAAAGGAGCTGATGGTTCTGAATACATCACATTGAGGGCATCTGATGTAATTGCTG
TGCTTCAGTAA\(3')AATGTTTTGTTATTTATTTAACAAGTCAATTTATTCTCAAACCAATATTTTGCCGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan