ESTScan Details for Unigene SGN-U233389

Score 
508
Direction 
Forward
Predicted Peptide Sequence 
KGADXLQAEDVVVKGKVVSANKGGVVALVEGLRGFIPFSQIFSKSTAEELLEKELPLKFVEVDQEQTRLILSNRKAMADSQTQLGIGSVV
LGIVQSLKPYGAFIDIGGVNGLLHVSQISHDRVSDISTILQPGDSLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLV
Predicted Coding Sequence 
AAAGGTGCAGACAAXCTTCAAGCTGAAGATGTTGTTGTCAAAGGTAAGGTGGTTAGTGCAAATAAAGGTGGAGTGGTGGCATTGGTCGAG
GGCCTTCGTGGGTTTATTCCATTCTCACAGATATTTTCGAAATCAACTGCAGAGGAGCTTTTGGAGAAAGAACTTCCTCTGAAATTTGTT
GAGGTTGATCAAGAGCAAACTAGACTTATACTCAGCAACCGCAAGGCCATGGCTGATAGTCAGACACAGTTGGGAATTGGGTCAGTTGTA
CTTGGAATTGTCCAGAGCTTGAAACCATATGGTGCCTTCATTGACATTGGTGGGGTCAATGGCCTTCTTCATGTCAGCCAGATCAGTCAT
GATCGTGTGTCAGATATCTCGACCATCCTTCAGCCTGGTGACTCTCTAAAGGTCATGATATTGAGCCATGACCGTGAGAGAGGTAGAGTG
AGCCTCTCTACAAAGAAGTTAGAACCTACACCTGGTGACATGATTCGCAATCCAAAGCTCGTX\
Edits in Original Sequence 
(5')AAAGGTGCAGACAAXCTTCAAGCTGAAGATGTTGTTGTCAAAGGTAAGGTGGTTAGTGCAAATAAAGGTGGAGTGGTGGCATTGGT
CGAGGGCCTTCGTGGGTTTATTCCATTCTCACAGATATTTTCGAAATCAACTGCAGAGGAGCTTTTGGAGAAAGAACTTCCTCTGAAATT
TGTTGAGGTTGATCAAGAGCAAACTAGACTTATACTCAGCAACCGCAAGGCCATGGCTGATAGTCAGACACAGTTGGGAATTGGGTCAGT
TGTACTTGGAATTGTCCAGAGCTTGAAACCATATGGTGCCTTCATTGACATTGGTGGGGTCAATGGCCTTCTTCATGTCAGCCAGATCAG
TCATGATCGTGTGTCAGATATCTCGACCATCCTTCAGCCTGGTGACTCTCTAAAGGTCATGATATTGAGCCATGACCGTGAGAGAGGTAG
AGTGAGCCTCTCTACAAAGAAGTTAGAACCTACACCTGGTGACATGATTCGCAATCCAAAGCTCGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan