ESTScan Details for Unigene SGN-U233476

Score 
334
Direction 
Forward
Predicted Peptide Sequence 
VFSTAPLSLSMASTLLTLAKPFTSHSTNLPSFSPQRPIGLRRNSLRINAISQKWEPTKVAPLCLFQVKVKLLXLLLILFVNEYXVVPQAD
RVLIRLEELPEKSAGGVLLPKSAVKFERYLMGEVLSVGSDVAQVETGKKVKPIEIFDF
Predicted Coding Sequence 
XCTGTATTCTCTACTGCTCCTCTCTCCTTATCCATGGCGTCTACATTGCTTACATTGGCTAAACCCTTCACTTCTCACTCAACAAATCTT
CCTTCTTTCTCTCCTCAAAGACCCATTGGTCTGAGAAGAAATTCTTTGAGAATTAATGCCATTTCCCAGAAATGGGAACCCACAAAGGTG
GCACCTTTATGCTTATTTCAAGTCAAAGTGAAATTACTTAAXTTGTTATTGATTTTGTTTGTTAATGAATATAGXGTTGTGCCGCAAGCT
GATAGAGTTTTGATTCGGTTAGAGGAATTGCCTGAGAAATCTGCTGGTGGAGTTTTGCTTCCGAAATCGGCAGTGAAGTTTGAGCGTTAT
CTTATGGGAGAAGTTCTTTCTGTTGGTTCTGACGTTGCTCAAGTAGAGACGGGGAAGAAGGTXAAGCCTATTGAAATTTTTGATTTT\
Edits in Original Sequence 
(5')XCTGTATTCTCTACTGCTCCTCTCTCCTTATCCATGGCGTCTACATTGCTTACATTGGCTAAACCCTTCACTTCTCACTCAACAAA
TCTTCCTTCTTTCTCTCCTCAAAGACCCATTGGTCTGAGAAGAAATTCTTTGAGAATTAATGCCATTTCCCAGAAATGGGAACCCACAAA
GGTGGCACCTTTATGCTTATTTCAAGTCAAAGTGAAATTACTTAAXTTGTTATTGATTTTGTTTGTTAATGAATATAGXGTTGTGCCGCA
AGCTGATAGAGTTTTGATTCGGTTAGAGGAATTGCCTGAGAAATCTGCTGGTGGAGTTTTGCTTCCGAAATCGGCAGTGAAGTTTGAGCG
TTATCTTATGGGAGAAGTTCTTTCTGTTGGTTCTGACGTTGCTCAAGTAGAGACGGGGAAGAAGGTXAAGCCTATTGAAATTTTTGATTT
T\(3')TT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan