ESTScan Details for Unigene SGN-U233569

Score 
71
Direction 
Reverse
Predicted Peptide Sequence 
KQPHFNPGKTTKFILKIPPFLGPLNILGGAVGPPLLHQTVNFLKIEKSVML
Predicted Coding Sequence 
XCAAAGCAGCCTCATTTCAACCCGGGCAAAACAACAAAGTTCATCCTTAAGATCCCCCCGTTTTTGGGTCCTTTGAATATTTTGGGAGGG
GCTGTTGGCCCXCCGCTTTTACACCAAACAGTCAACTTTTTGAAGATTGAAAAATCGGTGATGCTATAA\
Edits in Original Sequence 
(5')XCAAAGCAGCCTCATTTCAACCCGGGCAAAACAACAAAGTTCATCCTTAAGATCCCCCCGTTTTTGGGTCCTTTGAATATTTTGGG
AGGGGCTGTTGGCCCXCCGCTTTTACACCAAACAGTCAACTTTTTGAAGATTGAAAAATCGGTGATGCTATAA\(3')ATAACCACAAAT
GAAATCAACGAGACGTTTCAAGAACAGGTAGCTACCTTTTTTTCTGTTCCCAATTTTAACTTTTTCATCCTGGTGTTAAAAAAATCAATT
TTCGCCTCGTGAACCTGGTTTTTTTGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan