ESTScan Details for Unigene SGN-U233602

Score 
308
Direction 
Reverse
Predicted Peptide Sequence 
MPLPGMQLRRPSFVDPLMDNMVCLAEASGGMLKKAWMKVGPECLVAEEADSAAXDTTALGNKPLELEQPAVLLHQRPRTLAWELEVSPRV
ASVSGPLSPACLQXSSAAFTAPSLVVKLQKHNHAGPPF
Predicted Coding Sequence 
ATGCCCCTTCCTGGGATGCAATTACGGCGCCCATCCTTTGTGGATCCATTGATGGATAATATGGTCTGTCTTGCTGAGGCATCXGGGGGT
ATGTTGAAGAAGGCATGGATGAAGGTTGGTCCTGAGTGCCTGGTGGCTGAAGAGGCTGATTCTGCTGCTGXTGATACGACTGCTCTAGGC
AACAAACCACTTGAGTTAGAGCAGCCTGCTGTCTTGCTTCATCAGAGACCTCGGACTCTGGCTTGGGAACTTGAGGTCTCCCCCAGAGTA
GCTTCAGTCTCAGGCCCTTTATCACCAGCTTGTTTGCAAGXTTCCTCAGCTGCCTTCACCGCACCTTCTCTAGTCGTGAAGTTACAAAAG
CACAACCACGCTGGACCACCATTTTAA\
Edits in Original Sequence 
GAACTAAATGC(5')ATGCCCCTTCCTGGGATGCAATTACGGCGCCCATCCTTTGTGGATCCATTGATGGATAATATGGTCTGTCTTGCT
GAGGCATCXGGGGGTATGTTGAAGtAAGGCATGGATGAAGGTTGGTCCTGAGTGCCTGGTGGCTGAAGAGGCTGATTCTGCTGCTGXTGA
TACGACTGCTCTAGGCAACAAACCACTgTGAGTTAGAGCAGCCTGCTGTCTTGCTTCATCAGAGACCTCGGACTCTGGCTTGGGAACTTG
AGGTCTCCCCCAGAGTAGCTTCAGTCTCAGGCCCTTTATCACCAGCTTGTTTGCAAGXTTCCTCAGCTGCCTTCACCGCACCTTCTCTAG
TCGTGtAAGTTACAAAAGCACAACCACGCTGGACCACCATTTTAA\(3')CTCAATTTCACCATGAAAATAAAAATGGTCCCTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan