ESTScan Details for Unigene SGN-U233865

Score 
94
Direction 
Forward
Predicted Peptide Sequence 
CLTPHVSPEKTIINIDGLHHSIIEXGPVAWLGIFGHYLRSIVCDPPYILSPSPSPPPVKQAKLPARKVPGDYGLPLVGPWKDRLDYFYNQ
GX
Predicted Coding Sequence 
XXCTGCTTAACTCCTCATGTTTCTCCGGAGAAGACTATAATCAACATTGATGGACTGCACCATTCTATCATTGAGXTAGGTCCTGTAGCT
TGGCTAGGAATCTTTGGGCACTATCTACGCTCCATAGTGTGTGATCCACCTTACATTTTATCACCATCACCATCACCACCACCGGTTAAA
CAAGCGAAACTCCCAGCCAGAAAAGTTCCTGGAGATTATGGACTACCATTAGTTGGTCCATGGAAGGACAGACTTGATTACTTCTACAAT
CAGGGCAAX\
Edits in Original Sequence 
(5')XXCTGCTTAACTCCTCATGTTTCTCCGGAGAAGACgTATAATCAACATTGATGGACTGCACCATTCTATCATTGAGXTAGGTCCTG
TAGCTTGGCTAGGAATCTTTGGGCACTATCTACGCTCCATAGTGTGTGATaCCACCTTACATTTTATCACCATCACCATCACCACCACCG
GTTAAACAAGCGAAACTCCCAGCCAGAAAAGTTCCTGGAGATTATGGACTACCATTAGTTGGTCCATGGAAGGACAGACTTGATTACTTC
TACAATCAGGGCAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan