ESTScan Details for Unigene SGN-U234093

Score 
318
Direction 
Reverse
Predicted Peptide Sequence 
NGEWIDVNISPNSYVVLAGDSFKAWTNGRLHSPLHRVTMSGENDRLSIQLFSLSKPGHFIEAPKELVDEEPPLLFKPFEIIGLFDMGPQK
LAKQLLQVIFSKVIAVFDMLIANFRFSNQLF
Predicted Coding Sequence 
XXAAATGGAGAATGGATTGATGTGAATATTTCACCAAATTCTTATGTTGTTTTGGCTGGTGATTCCTTCAAAGCTTGGACAAATGGTCGA
TTGCATTCTCCTCTTCACAGAGTAACAATGTCCGGAGAAAATGATAGACTCTCCATTCAATTATTTTCATTATCAAAACCAGGTCACTTC
ATCGAGGCCCCAAAAGAACTAGTGGATGAAGAACCCCCTTTACTTTTCAAGCCATTTGAAATTATTGGATTATTTGATATGGGACCACAG
AAGCTGGCTAAACAGCTCCTCCAAGTGATTTTTTCAAAAGTTATTGCGGTGTTTGATATGCTAATTGCGAATTTCCGCTTCAGCAACCAA
CTTTTTTAA\
Edits in Original Sequence 
(5')XXAAATGGAGAATGGATTGATGTGAATATTTCACCAAATTCTTATGTTGTTTTGGCTGGTGATTCCTTCAAAGCTTGGACAAATGG
TCGATTGCATTCTCCTCTTCACAGAGTAACAATGTCCGGAGAAAATGATAGACTCTCCATTCAATTATTTTCATTATCAAAACCAGGTCA
CTTCATCGAGGCCCCAAAAGAACTAGTGGATGAAGAACCCCCTTTACTTTTCAAGCCATTTGAAATTATTGGATTATTTGAgTATGGGAC
CACAGAAGCTGGCTAAACAGCTCCTCCAAGTGATTTTTTCAAAAGTTATTGCGGTGTTTGATATGCTAATTGCGAATTTCCGCTTCAGCA
ACCAACTTTTTTAA\(3')TTTTTTTTGAAAAAAAATTGCATTGGGTTTCATTGGAAATTTGTGTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan