ESTScan Details for Unigene SGN-U234103

Score 
160
Direction 
Forward
Predicted Peptide Sequence 
TYLHSLSFKAWADEKKSPSVXSLRXELNLRPHGSQYTSLTTNDXLRCLVLLINIRVLIEIETETPVVSEDTINVLDDVQVFDLNGQGVPI
SDLWKDRKAVVAFALILGNLSIPYALFLPKLVIKKHVIGEVCATYSRSRLQMRPLSIRADYLAAEKGMLLLDYIYECYHVXSSMCSAETI
PKLTNVFPGPNDLSX
Predicted Coding Sequence 
ACGTATCTACACAGTTTGTCCTTCAAAGCTTGGGCAGATGAGAAAAAATCACCTAGTGTTXTTAGCCTCCGTTAGGAACTGAACCTCAGA
CCTCATGGTTCTCAATACACTTCATTGACTACTAATGATAAXTTAAGATGTTTAGTTTTGTTAATAAATATTAGAGTATTGATTGAAATA
GAAACTGAGACTCCAGTGGTGAGTGAGGACACCATCAATGTGTTGGACGATGTTCAAGTATTTGATCTGAATGGACAAGGAGTACCTATT
TCGGATTTGTGGAAAGATAGGAAGGCAGTTGTTGCCTTTGCTCTCATTTTGGGTAATCTTTCCATCCCTTATGCTCTATTTCTTCCAAAA
CTGGTAATCAAAAAGCATGTTATTGGTGAAGTATGTGCTACTTATTCTAGATCCCGATTGCAGATGCGTCCTTTGTCCATAAGAGCTGAT
TATCTTGCAGCTGAGAAAGGAATGCTTCTTCTTGACTACATTTACGAATGTTATCATGTTXTTTCTTCCATGTGTTCTGCTGAAACTATC
CCAAAGCTGACTAATGTATTTCCAGGTCCAAATGACTTGTCTTXX\
Edits in Original Sequence 
(5')ACGTATCTACACAGTTTGTCCTTCAAAGCTTGGGCAGATGAGAAAAAATCACCTAGTGTTXTTAGCCTCCGTTAGGAACTGAACCT
CAGACCTCATGGTTCTCAATACACTTCATTGACTACTAATGATAAXTTAAGATGTTTAGTTTTGTTAATAAATATTAGAGTATTGATTGA
AATAGAAACTGAGACTCCAGTGGTGAGTGAGGACACCATCAATGTGTTGGACGATGTTCAAGTATTTGATCTGAATGGACAAGGAGTACC
TATTTCGGATTTGTGGAAAGATAGGAAGGCAGTTGTTGCCTTTGCTCgTCATTTTGGGTAATCTTTCCATgCCCTTATGCTCTATTTCTT
CCAAAACTGGTAATCAAAAAGCATGTTATTGGTGAAGTATGTGCTACTTATTCTAGATCCCGATTGCAGATGCGTCCTTTGTCgCATAAG
AGCTGATTATCTTGCAGCTGAGAAAGGAATGCTTCTTCTTGACTACATTTACGAATGTTATCATGTTXTTTCTTCCATGTGTTCTGCTGA
AACTATCCCAAAGCTGACTAATGTATTTCCAGGTCCAAATGACTTGTCTTXX\(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan