ESTScan Details for Unigene SGN-U234154

Score 
391
Direction 
Forward
Predicted Peptide Sequence 
KSDNPKRYTGGSSSGSAAIVASGLCSAALGTDAGGSVRIPASLCGVVGLKTTFGRTDLTGSLWEAGTVTIIGPITATVEDAILXVSNWVY
CPFPYKQIVNSGHENLWYAAISGSSPTDRIQLNPSIPNFPDLSSSESSNILGSLTLGKYTKWFNDVSSTDISDKCEDVLNQLFRRYGCKT
TEIVIPELRELRTAHTVTFGSESLSFLNPX
Predicted Coding Sequence 
AAATCCGATAATCCAAAAAGGTACACAGGTGGTTCTTCCTCAGGTTCAGCTGCAATTGTCGCTTCTGGATTGTGCTCAGCAGCATTGGGA
ACAGATGCTGGAGGTTCAGTACGAATTCCTGCTTCTCTTTGCGGGGTTGTGGGCTTAAAAACAACATTTGGACGGACTGACCTGACAGGG
TCTTTGTGGGAAGCAGGAACTGTCACAATTATTGGACCCATCACAGCTACTGTTGAGGATGCCATACTTGXTGTTAGTAATTGGGTTTAC
TGCCCATTTCCTTACAAACAAATAGTCAATTCTGGTCATGAAAATCTCTGGTATGCAGCAATCTCGGGATCCTCTCCAACTGATCGAATT
CAGCTGAATCCTTCCATCCCTAATTTTCCCGATTTATCTTCCAGTGAGAGTTCAAATATCTTGGGATCACTTACCTTGGGAAAGTATACA
AAGTGGTTTAACGATGTTAGCTCGACCGACATATCTGATAAGTGTGAAGATGTCCTAAACCAACTATTTCGTCGGTATGGGTGCAAAACA
ACAGAGATTGTCATACCGGAGCTTCGTGAGCTGCGCACAGCTCATACTGTTACTTTTGGATCTGAATCACTGTCCTTTTTGAATCCTGAX
\
Edits in Original Sequence 
(5')AAATCCGcATAATCCAAAAAGGTACACAGGTGGTTCTTCCTCAGGTTCAGCTGCAATTGTCGCTTCTGGATTGTGCTCAGCAGCAT
TGGGAACAGATGCTGGAGGTTCAGTACGAATTCCTGCTTCTCTTTGCGGGGTTGTGGGCTTAAAAACAACATTTGGACGGACTGACCTGA
CAGGGTCTTTGTGGGAAGCAGGAACTGTCACAATTATTGGACCCATCACAGCTACTGTTGAGGATGCCATACTTGXTGTTAGTAATTGGG
TTTACTGCCCATTTCCTTACAAACAAATAGTCAATTCTGGTCATGAAAATCTCTGGTATGCAGCAATCTCGGGATCCTCTCCAACTGATC
GAATTCAGCTGAATCCTTCCATCCCTAATTTTCCCGATTTATCTTCCAGTGAGAGTTCAAATATCTTGGGATCACTTACCTTGGGAAAGT
ATACAAAGTGGTTTAACGATGTTAGCTCGACCGACATATCTGATAAGTGTGAAGATGTCCTAAACCAACTATTTCGTCGGTATGGGTGCA
AAACAACAGAGATTGTCATACCGGAGCTTCGTGAGCTGCGCACAGCTCATACTGTTACTTTTGGATCTGAATCACTGTCCTTTTTGAATC
CTGAX\(3')GATTGCGAGGCTGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan