ESTScan Details for Unigene SGN-U234194

Score 
14
Direction 
Forward
Predicted Peptide Sequence 
LPKEVWLFLLGYHSYDLIYADREHLEFVIKTDYXNDRKPMEDHLKEHAKRFIEFRERRGLIEKDVVRTDKLDSFYEEDDNPNINCLRDIL
LTYSFYNFDLGYCQGMSDLLSPIFVYMGDX
Predicted Coding Sequence 
XATCTACCTAAAGAGGTGTGGTTATTTCTGTTGGGATACCATTCATATGATTTAATTTATGCAGATAGGGAACACCTTGAGTTCGTCATA
AAGACAGATTATXTAAACGATAGAAAACCAATGGAAGATCATCTCAAGGAGCATGCAAAAAGATTTATAGAATTCCGAGAGAGGAGAGGC
CTCATTGAAAAAGATGTGGTGAGGACTGATAAGTTAGATTCATTCTATGAAGAGGATGACAACCCAAACATTAATTGTTTGCGTGATATA
CTGCTGACATACTCATTCTACAACTTTGATTTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCACCAATATTTGTTTATATGGGAGAT
GAX\
Edits in Original Sequence 
(5')XATCTACCTAAAGAGGTGTGGTTATTTCTGTTGGGATACCATTCATATGATTTAATTTATGCAGATAGGGAACACCTTGAGTTCGT
CATAAAGACAGATTATXTAAACGATAGAAAACCAATGGAAGATCATCTCtAAGGAGCATGCAAAAAGATTTATAGAATTCCGAGAGAGGA
GAGGCCTCATTGAAAAAGATGTGGTGAGGACTGATAAGTTAGATTCATTCTATGAAGAGGATGACAACCCAAACATTAATTGTTTGCGTG
ATATACTGCTGACATACTCATTCTACAACTTTGATTTGGGTTACTGTCAGGGTATGAGCGATCTTCTTTCACCAATATTTGTTTAtTATG
GGAGATGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan