ESTScan Details for Unigene SGN-U234223

Score 
319
Direction 
Forward
Predicted Peptide Sequence 
TMGKEKVHVNLVVIGHVDSGKSTTTGXLDLQGGGIDKRTIEKFEKEAKEMGKSSFKYAWVLDKLKAERERGITIDIALWKFETKKYYFTI
IDAPGHRDFIKNMITGTSQADVAILMIAGGVGEFEAGYAKNGQTREHALLAFTLGVKQMMVCINKMDDKSVNWGEPRYNEI
Predicted Coding Sequence 
XTCACAATGGGTAAGGAGAAGGTTCACGTTAACTTGGTCGTCATTGGACACGTCGACTCCGGCAAGTCCACCACCACTGGTXCACTTGAT
CTACAAGGCGGTGGTATCGACAAGCGTACCATCGAGAAGTTCGAGAAGGAAGCCAAGGAAATGGGCAAGTCCTCCTTCAAGTACGCCTGG
GTGCTCGACAAGCTGAAGGCCGAGCGTGAGCGTGGTATCACCATCGATATCGCTCTCTGGAAGTTCGAGACCAAGAAGTACTACTTCACC
ATTATTGATGCCCCGGGTCACCGTGACTTCATCAAGAACATGATTACTGGTACCTCCCAAGCCGATGTTGCCATTCTCATGATTGCTGGT
GGTGTTGGTGAGTTCGAGGCCGGTTATGCCAAGAACGGTCAAACCCGTGAGCACGCTCTTCTTGCCTTCACCCTCGGTGTGAAGCAAATG
ATGGTCTGCATCAACAAGATGGACGACAAGTCCGTCAACTGGGGTGAGCCTCGTTACAACGAAATC\
Edits in Original Sequence 
(5')XTCACAATGGGTAAGGAGAAGGTTCACGTTAACTTGGTCGTCATTGGACACGTCGACTCCGGCAAGTCCACCACCACTGGTXCACT
TGATCTACAAGtGCGGTGGTATCGACAAGCGTACCATCGAGAAGTTCGAGAAGGAAGCCAAGGAAATGGGCAAGTCCTCCTTCAAGTACG
CCTGGGTGCTCGACAAGCTGAAGGCCGAGCGTGAGCGTGGTATCACCATCGATATCGCTCTCTGGAAGTTCGAGACCAAGAAGTACTACT
TCACCATTATTGATGCCCCGGGTCACCGTGACTTCATCAAGAACATGATTACTGGTACCTCCCAAGCCGATGTTGCCATTCTCATGATTG
CTGGTGGTGTTGGTGAGTTCGAGGCCGGTTATGCCAAGAACGGTCAAACCCGTGAGCACGCTCTTCTTGCCTTCACCCTCGGTGTGAAGC
AAATGATGGTCTGCATCAACAAGATGGACGACAAGTCCGTCAACTGGGGTGAGCCTCGTTACAACGAAATC\(3')TCAAGGACGAAGTT
TCCAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan