ESTScan Details for Unigene SGN-U234380

Score 
6
Direction 
Forward
Predicted Peptide Sequence 
SPPPSLSLGNHVQNPAFTLRYRPPDLWTIAKCPLEDIALSDCKSYSCPPFYYAYGGGGGGGKLYSDELSIPMSSPSLILKNFTFGCAHSA
LGEPIGVAGFGRGTLSLPAQLANNSPEIGNYFSYWLVSHTFDTIKFIDPVRSFSADT
Predicted Coding Sequence 
XXCTCACCTCCGCCGTCCCTGTCTCTCGGAAATCACGTGCAAAATCCGGCGTTCACTCTTCGTTACCGTCCTCCXGACCTCTGGACTATC
GCGAAATGCCCACTTGAAGATATTGCCCTTTCTGATTGCAAGTCGTATTCGTGTCCCCCTTTTTACTATGCTTATGGTGGGGGGGGGGGG
GGGGGGAAACTTTACAGCGATGAATTATCAATACCCATGTCGTCTCCATCGTTGATTTTGAAGAATTTTACATTTGGGTGTGCTCACAGT
GCTCTCGGTGAACCCATCGGAGTAGCTGGATTTGGCCGGGGGACACTTTCATTGCCGGCGCAACTCGCGAATAACTCCCCGGAAATCGGA
AATTACTTCTCTTATTGGTTAGTTTCTCACACTTTTGACACAATCAAGTTCATCGACCCAGTCCGCTCATTCTCGGCCGATACX\
Edits in Original Sequence 
(5')XXCTCACCTCCGCCGTCCCTGTCTCTCGGAAATCACGTGCAAAATCCGGCGTTCACTCTTCGTTACCGTCCTCCXGACCTCTGGAC
TATCGCGAAATGCCCACTTGAAGATATTGCCCTTTCTGATTGCAAGTCGTATTCGTGTCCCCCTTTTTACTATGCTTATGGTGGGGGGGG
GGGGGGGGGGAAACTTTACAGCGATGAATTATCAATACCCATGTCGTCTCCATCGTTGATTTTGAAGAATTTTACATTTGGGTGTGCTCA
CAGTGCTCTCGGTGAACCCATCGGAGTAGCTGGATTTGGCCGGGGGACACTTTCATTGCCGGCGCAACTCGCGAATAACTCCCCGGAAAT
CGGAAATTACTTCTCTTATTGGTTAGTTTCTCACACTTTTGACACgAATCAAGTTCATCGACCCAGTCCGCTCATTCTCGGCCGATACX\
(3')TTCTCGGCCGATACTCTATCTATGAAAAAATGAAACAGATGAAGAATTATTACTCCGATTACGCTTACACCCCAATGCTCAATAAC
CCGGGGGGGGGGGGGGGGGTACACCCTCCGACTCGAAGGTGTATCAATCGGAAAAACAAAAATCCCGGCGCCGGGGAGTTTACGGCGAGT
TGACAAAAGAGGAAACGGCGGAATGGTGGTGGATTCCGGTACAACTTTCACTATGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan