ESTScan Details for Unigene SGN-U234501

Score 
424
Direction 
Forward
Predicted Peptide Sequence 
MEYDPSLKKGIDDQRPGLRTVDSGIADSRILLGPSHELAEELNCAGXTLQVPVVDLSGIEVEDRRKKIVDEIRDASEKWGFFQLINHGIP
SSVLEGMIDGTRKFHEQDVEVKKEYYSSDPRRGVRFESNLQLLTTKGRNATXKDTLYISKSVSEPEEIPEVCRRILVEYKNHVIILGDIL
Predicted Coding Sequence 
ATGGAATATGATCCATCATTGAAAAAAGGCATTGATGATCAAAGGCCXGGGTTAAGGACTGTTGATTCAGGAATAGCAGATTCAAGAATT
TTATTAGGXCCATCTCATGAACTTGCTGAGGAGTTGAATTGTGCAGGTXCAACTCTACAGGTTCCAGTGGTGGATCTAAGTGGCATAGAA
GTTGAAGATCGACGTAAGAAGATTGTCGATGAAATAAGGGATGCATCTGAGAAATGGGGATTTTTTCAACTGATAAATCATGGGATTCCT
TCAAGTGTTTTGGAAGGAATGATTGATGGAACTCGTAAATTTCATGAACAAGATGTCGAAGTGAAGAAAGAGTACTATTCGTCTGATCCA
AGACGAGGAGTTAGATTTGAGAGTAATCTTCAACTGTTGACAACAAAAGGTAGAAATGCAACCTGNAAGGATACATTGTATATCTCTAAG
TCAGTTTCTGAACCTGAAGAAATACCAGAAGTTTGCAGGAGAATATTGGTTGAGTACAAAAATCATGTTATAATACTAGGGGACATTCTX
\
Edits in Original Sequence 
GGTCCATTATTTTGGAAGTCATATCATTTTTCATTGAACTACTGACGCTTCATTCGTA(5')ATGGAATATGATCCATCATTGAAAAAAG
GCtATTGATGATCAAAGGCCXGGGTTAAGGACTGTTGATTCAGGAATAGCAGATTCAAGAATTTTATTAGGXCCATCTCATGAACTTGCT
GAGGAGTTGAATTGTGCAGGTXCAACTCTACAGGTTCCAGTGGTGGATCTAAGTGGCATAGAAGTTGAAGATCGACGTAAGAAGATTGTC
GATGAAATAAGGGATGCATCTGAGAAATGGGGATTTTTTCAACTGATAAATCATGGGATTCCTTCAAGTGTTTTGGAAGGAATGATTGAT
GGAACTCGTAAATTTCATGAACAAGATGTCGAAGTGAAGAAAGAGTACTATTCGTCTGATCCAAGACGAGGAGTTAGATTTGAGAGTAAT
CTTCAACTGTTGACAACAAAAGGTAGAAATGCAACCTGNAAGGATACATTGTATATCTCTAAGTCAGTTTCTGAACCTGAAGAAATACCA
GAAGTTTGCAGGAGAATATTGGTTGAGTACAAAAATCATGTTATAATACTAGGGGACATTCTX\(3')ATTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan