ESTScan Details for Unigene SGN-U234538

Score 
259
Direction 
Forward
Predicted Peptide Sequence 
KRKRKGALFAEFIHEKKANXKLLYFDQEENGGLSLALQAEVHSTKIGGLCGLSIELRPYAKRTKPSIKXNGLEEVPSSPGLTQDGDKSFS
SHFSDAYAVFIFSFYFVAFGFHTLSYKLGHLPSDYSQFISCQKSLFIVDANLIYDPGMTASLISAXKFFATSLQEDSSKTGKVTSAGMYF
LGFPVYHMDQTQTSAAATKDPDSAFFKKLDGFQPCEITELKAGTHVFAIYGDNFFKSVSYTIEVVCAEPFTXGKENLRAVEAX
Predicted Coding Sequence 
AAAAGGAAGCGAAAGGGGGCCTTGTTTGCCGAGTTCATTCACGAGAAAAAAGCAAATXTTAAGCTATTGTACTTTGACCAAGAAGAAAAT
GGTGGACTAAGCCTTGCATTACAGGCTGAAGTTCACTCGACAAAGATTGGGGGACTTTGTGGCTTAAGCATTGAGCTCAGGCCTTACGCC
AAGCGAACTAAGCCTAGTATTAAGXTGAATGGTCTAGAGGAGGTGCCATCATCCCCGGGTTTGACTCAAGATGGGGACAAAAGTTTCTCC
AGTCACTTTTCTGACGCATATGCTGTGTTCATATTTTCTTTCTATTTTGTGGCATTTGGTTTTCATACGCTCTCATATAAGCTAGGCCAT
CTTCCCTCAGATTACTCGCAGTTCATCAGTTGCCAAAAATCACTCTTCATTGTTGATGCTAATCTGATTTATGATCCTGGCATGACTGCT
TCATTAATATCTGCTGXTAAATTTTTTGCGACTTCTTTGCAGGAAGATAGTTCAAAAACAGGGAAAGTCACATCTGCTGGCATGTATTTT
CTTGGTTTCCCAGTATATCACATGGATCAAACCCAGACATCGGCAGCAGCCACAAAGGATCCGGACTCTGCATTTTTCAAGAAACTGGAT
GGATTTCAACCATGCGAGATAACTGAGCTCAAAGCTGGCACACATGTTTTTGCAATTTATGGTGACAATTTTTTTAAAAGTGTGAGCTAC
ACCATTGAAGTGGTCTGCGCTGAACCTTTTACTGANGGAAAAGAGAATCTTAGAGCAGTAGAAGCTCXX\
Edits in Original Sequence 
(5')AAAAGGAAGCGAAAGGGGGCCTTGTTTGCCGAGTTCATTCACGAGAAAAAAGCAAATXTTAAGCTATTGTACTTTGACCAAGAAGA
AAATGGTGGACTAAGCCTTGCATTACAGGCTGAAGTTCACTCGACAAAGATTGGGGGACTTTGTGGCTTAAGCATTGAGCTCAGGCCTTA
CGCCAAGCGAACTAAGCCTAGTATTAAGXTGAATGGTCTAGAGGAGGTGCCATCATCCCCGGGTTTGACTCAAGATGGGGACAAAAGTTT
CTCCAGTCACTTTTCTGACGCATATGCTGTGTTCATATTTTCTTTCTATTTTGTGGCATTTGGTTTTCATACGCTCTCATATAAGCTAGG
CCATCTTCCCTCAGATTACTCGCAGTTCATCAGTTGCCAAAAATCACTCTTCATTGTTGATGCTAATCTGATTTATGATCCTGGCATGAC
TGCTTCATTAATATCTGCTGXTAAATTTTTTGCGACTTCTTTGCAGGAAGATAGTTCAAAAACAGGGAAAGTCACATCTGCTGGCATGTA
TTTTCTTGGTTTCCCAGTATATCACATGGATCAAACCCAGACATCGGCAGCAGCCACAAAGGATCCGGACTCTGCATTTTTCAAGAAACT
GGATGGATTTCAACCATGCGAGATAACTGAGCTCAAAGCTGGCACACATGTTTTTGCAATTTATGGTGACAATTTTTTTAAAAGTGTGAG
CTACACCATTGAAGTGGTCTGCGCTGAACCTTTTACTGANGGAAAAGAGAATCTTAGAGCAGTAGAAGCTCXX\(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan