ESTScan Details for Unigene SGN-U234553

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
GFRGSGEILKKLIFRWPESVIGKLDLVFLDAPFPAQGKSPLEGFFDPPYYEWFQANKDFTEFYNFEECLEYIEDFMLKNGPFDGVLGFSQ
VKIYSTLI
Predicted Coding Sequence 
GGCTTTAGAGGAAGTGGTGAAATACTCAAGAAATTGATTTTCCGGTGGCCGGAATCCGTCATCGGAAAATTAGATTTGGTGTTTTTGGAT
GCACCTTTTCCGGCTCAGGGGAAATCTCCACTTGAAGGTTTTTTTGATCCTCCTTACTATGAATGGTTTCAAGCAAATAAGGATTTTACA
GAATTTTACAATTTTGAAGAATGCCTTGAGTATATAGAAGATTTTATGTTAAAGAATGGACCTTTTGATGGTGTTCTTGGTTTCTCACAG
GTXAAGATTTACTCAACTCTCATTTAG\
Edits in Original Sequence 
(5')GGCTTTAGAGGAAGTGGTGAAATACTCAAGAAATTGATTTTCCGGTGGCCGGAATCCGTCATCGGAAAATTAGATTTGGTGTTTTT
GGATGCACCTTTTCCGGCTCAGGGGAAATCTCCACTTGAAGGTTTTTTTGATCCTCCTTACTATGAATGGTTTCAAGCAAATAAGGATTT
TACAGAATTTTACAATTTTGAAGAATGCCTTGAGTATATAGAAGATTTTATGTTAAAGAATGGACCTTTTGATGGTGTTCTTGGTTTCTC
ACAGGTXAAGATTTACTCAACTCTCATTTAG\(3')GGTTGTTTTTTCTTTTCTGTAAGCGTAAACGAGAAGAAATAATCTTTTACAATC
AGTTATATTTTAAATAAGAGAACGATCTCAGAAAGATTACTTGTGTTATTTCTAAAGGATAATAACAGTTTTTAGTATAAATAGACACTT
TAACATTGCATGTACTTAGTCAATTAAATAGTGTAACGAGTTATAATTCAACGAATTTGATAAGTCTCACAAGTAGCTAAGGATGAAATA
TGCACTACATCTTCAATTAATCGAAGATTCAATATGCTTAGTCAGATATTATAACCGATCTGTTTTTTTTCTTTTTGGTGTGTGGTGTGT
GGGGTGAAAATANGGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan