ESTScan Details for Unigene SGN-U234571

Score 
234
Direction 
Forward
Predicted Peptide Sequence 
MATDFKFIPLIDVSPLLEKWDHPNITQDEGVAQVVRQLDQACREAGFFYVVMLLCLLIFVFMDFIGGLGNSLLKKEVQDCVKPLCDPALV
GPVYKRVLSALGDLDXQPNFWFYPICNFGEIVAVTEKEAKLXTKFKLDLSYKSIDCCRISVHLISTGVCSAILX
Predicted Coding Sequence 
ATGGCTACAGATTTCAAGTTTATCCCTCTTATAGATGTGAGTCCTCTTTTGGAGAAGTGGGATCATCCAAATATTACTCAAGATGAAGGT
GTAGCTCAAGTTGTTAGGCAATTAGATCAGGCTTGTAGAGAAGCTGGATTCTTTTATGTGGTAATGCTTCTTTGCCTTCTAATATTTGTA
TTTATGGATTTTATTGGTGGCCTTGGAAATAGCCTCTTGAAAAAGGAAGTGCAAGACTGCGTTAAACCCTTGTGTGATCCGGCCCTTGTT
GGACCTGTGTATAAACGGGTGCTAAGTGCCCTTGGCGATCTTGATXTGCAGCCTAATTTTTGGTTTTATCCAATTTGCAATTTTGGGGAA
ATAGTTGCTGTCACTGAGAAAGAAGCTAAGCTTXTTACTAAGTTTAAGTTGGATCTTTCATATAAATCAATTGATTGTTGTAGGATTAGT
GTCCATTTGATCTCTACTGGTGTTTGTTCTGCAATCTTGCXX\
Edits in Original Sequence 
GGACTGGCAGAATTAATAGATTCCAAACTGCATATTCTAGCGAACTAAGAAGAAGAAACACAGAAAACTGGAAGCA(5')ATGGCTACAG
ATTTCAAGTTTATCCCTCTTATAGATGTGAGTCCTCTTTTGGAGAAGTGGGATCATCCAAATATTACTCAAGATGAAGGTGTAGCTCAAG
TTGTTAGGCAATTAGATCAGGCTTGTAGAGAAGCTGGATTCTTTTATGTGGTAATGCTTCTTTaGCCTTCTAATATTTGTATTTATGGAT
TTTATTGGTGGCCTTGGAAATAGCCTCTTGtAAAAAGGAAGTGCAAGACTGCGTTAAACCCTTGTGTGATCCGGCCCTTGTTGGACCTGT
GTATAAACGGGTGCTAAGTGCCCTTGGCGATCTTGATXTGCAGCCTAATTTTTGGTTTTATCCAATTTGCAATTTTGGGGAAATAGTgTG
CTGTCACTGAGAAAGAAGCTAAGCTTXTTACTAAGTTTAAGTTGGATCTTTCATATAAATCAATTGATTGTTGTAGGATTAGTGTCCATT
TGATCTCTACTGGTGTTTGTTCTGCAATCTTGCXX\(3')GC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan