ESTScan Details for Unigene SGN-U234575

Score 
196
Direction 
Forward
Predicted Peptide Sequence 
MQMTTDQLSRSSRPITIHGLAQSGDVVAFKKLLNDNPFLLNERNPVMVHEPLHVATGYNNVYILKFLLSWPGPQQLELETYNMYGETPLH
MVPKNG
Predicted Coding Sequence 
ATGCAGATGACCACGGATCAACTTTCAAGATCTTCCAGACCCATAACTATTCATGGGTTAGCACAATCTGGGGATGTTGTTGCCTTTAAA
AAGTTGCTAAATGACAACCCTTTTCTTCTTAATGAACGTAACCCTGTTATGGTGCATGAGCCTCTTCATGTTGCTACTGGATACAACAAT
GTCTACATACTCAAGTTTTTGCTCAGTTGGCCGGGCCCACAGCAACTGGAGCTGGAAACCTATAACATGTATGGAGAGACTCCTTTGCAC
ATGGTCCCCAAGAATGGT\
Edits in Original Sequence 
TGTTGCTGATACCCATAGGGGATTCTAATATAGGATAA(5')ATGCAGATGACCACGGATCAACTTTCAAGATCTTCCAGACCCATAACT
ATTCATGGGTTAGCACAATCTGGGGATGTTGTTGCCTTTAAAAAGTTGCTAAATGACAACCCTTTTCTTCTTAATGAACGTAACCCTGTT
ATGGTGCATGAcGCCTCTTCATGTTGCTACTGGATACAACAATGTCTACATACTCAAGTTTTTGCTCAGTTGGCCGGGCCCACAGCAACT
GGAGCTGGAAACCTATAACATGTATGGAGAGACTCCTTTGCACATGGTCCCCAAGAATGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan